- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-FHL1 (ARP34378_T100-HRP) antibody |
---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep |
---|---|
Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
Clonality | Polyclonal |
Host | Rabbit |
Conjugation | HRP: Horseradish Peroxidase |
Application | IHC, WB |
Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human FHL1 |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100% |
Peptide Sequence | Synthetic peptide located within the following region: YYCVDCYKNFVAKKCAGCKNPITGFGKGSSVVAYEGQSWHDYCFHCKKCS |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-FHL1 (ARP34378_T100-HRP) antibody is Catalog # AAP34378 (Previous Catalog # AAPY00220) |
Reference | McGrath,M.J., et al., (2003) Am. J. Physiol., Cell Physiol. 285 (6), C1513-C1526 |
Publications | Windpassinger, C. et al. An X-linked myopathy with postural muscle atrophy and generalized hypertrophy, termed XMPMA, is caused by mutations in FHL1. Am. J. Hum. Genet. 82, 88-99 (2008). WB, IHC, Mouse, Human, Sheep, Dog, Bovine, Horse, Guinea pig, Rat, Rabbit 18179888 Quinzii, C. M. et al. X-linked dominant scapuloperoneal myopathy is due to a mutation in the gene encoding four-and-a-half-LIM protein 1. Am. J. Hum. Genet. 82, 208-13 (2008). WB, Mouse, Human, Sheep, Dog, Bovine, Horse, Guinea pig, Rat, Rabbit 18179901 Schoser, B. et al. Consequences of mutations within the C terminus of the FHL1 gene. Neurology 73, 543-51 (2009). WB, Mouse, Human, Sheep, Dog, Bovine, Horse, Guinea pig, Rat, Rabbit 19687455 Gueneau, L. et al. Mutations of the FHL1 gene cause Emery-Dreifuss muscular dystrophy. Am. J. Hum. Genet. 85, 338-53 (2009). IHC, Mouse, Human, Sheep, Dog, Bovine, Horse, Guinea pig, Rat, Rabbit 19716112 Sharma, P., Shathasivam, T., Ignatchenko, V., Kislinger, T. & Gramolini, A. O. Identification of an FHL1 protein complex containing ACTN1, ACTN4, and PDLIM1 using affinity purifications and MS-based protein-protein interaction analysis. Mol. Biosyst. 7, 1185-96 (2011). WB, Mouse, Human, Sheep, Dog, Bovine, Horse, Guinea pig, Rat, Rabbit 21246116 Dong, R. et al. Cells with dendritic cell morphology and immunophenotype, binuclear morphology, and immunosuppressive function in dendritic cell cultures. Cell. Immunol. 272, 1-10 (2011). WB, Mouse, Human, Sheep, Dog, Bovine, Horse, Guinea pig, Rat, Rabbit 22053194 Koike, K. et al. High prevalence of epigenetic inactivation of the human four and a half LIM domains 1 gene in human oral cancer. Int. J. Oncol. 42, 141-50 (2013). WB, IHC, Mouse, Human, Sheep, Dog, Bovine, Horse, Guinea pig, Rat, Rabbit 23123766 Fujii, T. et al. A case of adult-onset reducing body myopathy presenting a novel clinical feature, asymmetrical involvement of the sternocleidomastoid and trapezius muscles. J. Neurol. Sci. 343, 206-10 (2014). WB, Mouse, Human, Sheep, Dog, Bovine, Horse, Guinea pig, Rat, Rabbit 24928078 |
Gene Symbol | FHL1 |
---|---|
Gene Full Name | Four and a half LIM domains 1 |
Alias Symbols | KYOT, SLIM, FCMSU, FHL-1, FHL1A, FHL1B, FLH1A, SLIM1, XMPMA, RBMX1A, RBMX1B, SLIM-1, SLIMMER |
NCBI Gene Id | 2273 |
Protein Name | Four and a half LIM domains protein 1 |
Description of Target | LIM proteins, named for 'LIN11, ISL1, and MEC3,' are defined by the possession of a highly conserved double zinc finger motif called the LIM domain. FHL1 may play an important role during the early stages of skeletal muscle differentiation, specifically in alpha5beta1-integrin-mediated signaling pathways. |
Uniprot ID | Q6IB30 |
Protein Accession # | NP_001440 |
Nucleotide Accession # | NM_001449 |
Protein Size (# AA) | 280 |
Molecular Weight | 32kDa |
Protein Interactions | SUMO2; UBC; SRPK1; SMAD4; SMAD3; SMAD2; LMNA; CSNK1D; NRIP1; ESR1; HIVEP3; SMURF1; UBE2E2; STAT4; RING1; RBPJ; FHL1; KCNA5; PRNP; USP15; HHV8GK18_gp81; SP1; TXNIP; DEAF1; PDE4DIP; AKAP12; EED; HES1; DBN1; CBX4; FHL2; SRF; MYBPC1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "FHL1 Antibody - C-terminal region : HRP (ARP34378_T100-HRP)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep".
-
How long will it take to receive "FHL1 Antibody - C-terminal region : HRP (ARP34378_T100-HRP)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "FHL1 Antibody - C-terminal region : HRP (ARP34378_T100-HRP)" provided in?
This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "FHL1 Antibody - C-terminal region : HRP (ARP34378_T100-HRP)"?
This target may also be called "KYOT, SLIM, FCMSU, FHL-1, FHL1A, FHL1B, FLH1A, SLIM1, XMPMA, RBMX1A, RBMX1B, SLIM-1, SLIMMER" in publications.
-
What is the shipping cost for "FHL1 Antibody - C-terminal region : HRP (ARP34378_T100-HRP)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "FHL1 Antibody - C-terminal region : HRP (ARP34378_T100-HRP)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "FHL1 Antibody - C-terminal region : HRP (ARP34378_T100-HRP)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "32kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "FHL1 Antibody - C-terminal region : HRP (ARP34378_T100-HRP)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "FHL1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "FHL1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "FHL1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "FHL1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "FHL1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "FHL1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.