Search Antibody, Protein, and ELISA Kit Solutions

FHL1 antibody - C-terminal region (ARP34378_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP34378_T100-FITC Conjugated

ARP34378_T100-HRP Conjugated

ARP34378_T100-Biotin Conjugated

Gene Symbol:
FHL1
NCBI Gene Id:
2273
Official Gene Full Name:
Four and a half LIM domains 1
Protein Name:
Four and a half LIM domains protein 1
Swissprot Id:
Q6IB30
Protein Accession #:
NP_001440
Nucleotide Accession #:
NM_001449
Alias Symbols:
KYOT, SLIM, FHL-1, FHL1A, FHL1B, FLH1A, SLIM1, XMPMA, SLIM-1, SLIMMER
Replacement Item:
This antibody may replace item sc-101046 from Santa Cruz Biotechnology.
Description of Target:
LIM proteins, named for 'LIN11, ISL1, and MEC3,' are defined by the possession of a highly conserved double zinc finger motif called the LIM domain. FHL1 may play an important role during the early stages of skeletal muscle differentiation, specifically in alpha5beta1-integrin-mediated signaling pathways.
Protein Size (# AA):
280
Molecular Weight:
32kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FHL1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FHL1.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human FHL1
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%
Complete computational species homology data:
Anti-FHL1 (ARP34378_T100)
Peptide Sequence:
Synthetic peptide located within the following region: YYCVDCYKNFVAKKCAGCKNPITGFGKGSSVVAYEGQSWHDYCFHCKKCS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SUMO2; UBC; SRPK1; SMAD4; SMAD3; SMAD2; LMNA; CSNK1D; NRIP1; ESR1; HIVEP3; SMURF1; UBE2E2; STAT4; RING1; RBPJ; FHL1; KCNA5; PRNP; USP15; HHV8GK18_gp81; SP1; TXNIP; DEAF1; PDE4DIP; AKAP12; EED; HES1; DBN1; CBX4; FHL2; SRF; MYBPC1;
Blocking Peptide:
For anti-FHL1 (ARP34378_T100) antibody is Catalog # AAP34378 (Previous Catalog # AAPY00220)
Datasheets/Manuals:
Printable datasheet for anti-FHL1 (ARP34378_T100) antibody
Target Reference:
McGrath,M.J., et al., (2003) Am. J. Physiol., Cell Physiol. 285 (6), C1513-C1526
Publications:

Windpassinger, C. et al. An X-linked myopathy with postural muscle atrophy and generalized hypertrophy, termed XMPMA, is caused by mutations in FHL1. Am. J. Hum. Genet. 82, 88-99 (2008). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 18179888

Quinzii, C. M. et al. X-linked dominant scapuloperoneal myopathy is due to a mutation in the gene encoding four-and-a-half-LIM protein 1. Am. J. Hum. Genet. 82, 208-13 (2008). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 18179901

Schoser, B. et al. Consequences of mutations within the C terminus of the FHL1 gene. Neurology 73, 543-51 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 19687455

Gueneau, L. et al. Mutations of the FHL1 gene cause Emery-Dreifuss muscular dystrophy. Am. J. Hum. Genet. 85, 338-53 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 19716112

Sharma, P., Shathasivam, T., Ignatchenko, V., Kislinger, T. & Gramolini, A. O. Identification of an FHL1 protein complex containing ACTN1, ACTN4, and PDLIM1 using affinity purifications and MS-based protein-protein interaction analysis. Mol. Biosyst. 7, 1185-96 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 21246116

Dong, R. et al. Cells with dendritic cell morphology and immunophenotype, binuclear morphology, and immunosuppressive function in dendritic cell cultures. Cell. Immunol. 272, 1-10 (2011). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 22053194

Koike, K. et al. High prevalence of epigenetic inactivation of the human four and a half LIM domains 1 gene in human oral cancer. Int. J. Oncol. 42, 141-50 (2013). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 23123766

Fujii, T. et al. A case of adult-onset reducing body myopathy presenting a novel clinical feature, asymmetrical involvement of the sternocleidomastoid and trapezius muscles. J. Neurol. Sci. 343, 206-10 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 24928078

Xue, Y; Schoser, B; Rao, AR; Quadrelli, R; Vaglio, A; Rupp, V; Beichler, C; Nelson, SF; Schapacher-Tilp, G; Windpassinger, C; Wilcox, WR; Exome Sequencing Identified a Splice Site Mutation in FHL1 that Causes Uruguay Syndrome, an X-Linked Disorder With Skeletal Muscle Hypertrophy and Premature Cardiac Death. 9, 130-5 (2016). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 26933038

Le Thanh, P; Meinke, P; Korfali, N; Srsen, V; Robson, MI; Wehnert, M; Schoser, B; Sewry, CA; Schirmer, EC; Immunohistochemistry on a panel of Emery-Dreifuss muscular dystrophy samples reveals nuclear envelope proteins as inconsistent markers for pathology. 27, 338-351 (2017). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 28214269

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...