$0.00
In stock
SKU
OPCA02217
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Fhit Recombinant Protein (OPCA02217)

Catalog#: OPCA02217
Domestic: within 4-6 weeks delivery International: 4-6 weeks
More Information
Product Format Liquid
Host Mouse
Additional Information Relevance: Cleaves P(1)-P(3)-bis(5'-adenosyl) triphosphate (Ap3A) to yield AMP and ADP. Can also hydrolyze P(1)-P(4)-bis(5'-adenosyl) tetraphosphate (Ap4A), but has extrely low activity with ATP. Modulates transcriptional activation by CTNNB1 and thereby contributes to regulate the expression of genes essential for cell proliferation and survival, such as CCND1 and BIRC5. Plays a role in the induction of apoptosis via SRC and AKT1 signaling pathways. Inhibits MDM2-mediated proteasomal degradation of p53/TP53 and thereby plays a role in p53/TP53-mediated apoptosis. Induction of apoptosis depends on the ability of FHIT to bind P(1)-P(3)-bis(5'-adenosyl) triphosphate or related compounds, but does not require its catalytic activity . Functions as tumor suppressor.
Reconstitution and Storage Store at -20C. Avoid freeze thaw cycles.
Formulation 20 mM Tris-HCl based buffer, pH 8.0
Purity Greater than 90% as determined by SDS-PAGE.
Protein Sequence SFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLHPDEVADLFQVTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHVLPRKAGDFPRNDNIYDELQKHDREEEDSPAFWRSEKEMAAEAEALRVYFQA
Storage Buffer 20 mM Tris-HCl based buffer, pH 8.0
Source E.coli
Tag His-tag
Target Reference The murine Fhit locus isolation, characterization, and expression in normal and tumor cells.Pekarsky Y., Druck T., Cotticelli M.G., Ohta M., Shou J., Mendrola J., Montgomery J.C., Buchberg A.M., Siracusa L.D., Manenti G., Fong L.Y., Dragani T.A., Croce C.M., Huebner K.Cancer Res. 58:3401-3408(1998)
Nitrilase and Fhit homologs are encoded as fusion proteins in Drosophila melanogaster and Caenorhabditis elegans.Pekarsky Y., Campiglio M., Siprashvili Z., Druck T., Sedkov Y., Tillib S., Draganescu A., Wermuth P., Rothman J.H., Huebner K., Buchberg A.M., Mazo A., Brenner C., Croce C.M.Proc. Natl. Acad. Sci. U.S.A. 95:8744-8749(1998)
Muir-Torre-like syndrome in Fhit-deficient mice.Fong L.Y., Fidanza V., Zanesi N., Lock L.F., Siracusa L.D., Mancini R., Siprashvili Z., Ottey M., Martin S.E., Druck T., McCue P.A., Croce C.M., Huebner K.Proc. Natl. Acad. Sci. U.S.A. 97:4742-4747(2000)
The tumor spectrum in FHIT-deficient mice.Zanesi N., Fidanza V., Fong L.Y., Mancini R., Druck T., Valtieri M., Rudiger T., McCue P.A., Croce C.M., Huebner K.Proc. Natl. Acad. Sci. U.S.A. 98:10250-10255(2001)
Datasheets/Manuals Printable datasheet for Fhit Recombinant Protein (Mouse) (OPCA02217)
Gene Symbol Fhit
Official Gene Full Name bis(5'-adenosyl)-triphosphatase
Alias Symbols Fra14A2, AW045638
NCBI Gene Id 14198
Protein Name bis(5'-adenosyl)-triphosphatase
Description of Target This gene encodes a member of the HIT family of proteins that are characterized by the presence of a histidine triad sequence. The encoded protein is a diadenosine triphosphate hydrolase enzyme that cleaves the P(1)-P(3)-bis(5'-adenosyl) triphosphate (Ap3A) to yield AMP and ADP. This locus is very fragile and has been found to be altered in different types of cancers. Mice lacking the encoded protein display increased susceptibility to spontaneous and induced tumors. Ectopic expression of the encoded protein in such knockout mice inhibits tumor development. Alternative splicing results in multiple transcript variants encoding different isoforms.
Swissprot Id O89106
Protein Accession # NP_001295215.1
Nucleotide Accession # NM_001308286.1
Molecular Weight 21 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express Fhit.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express Fhit.
Write Your Own Review
You're reviewing:Fhit Recombinant Protein (OPCA02217)
Your Rating