Size:100 ug
$299.00
In stock
SKU
OAAF07895
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

OAAF07895-FITC Conjugated

OAAF07895-HRP Conjugated

OAAF07895-Biotin Conjugated

FHIT Antibody (OAAF07895)

Catalog#: OAAF07895
Domestic: within 1 week delivery  International: 1 week
More Information
Predicted Species Reactivity Human
Clonality Polyclonal
Host Rabbit
Application IHC
Reconstitution and Storage Stable at -20C for at least 1 year.
Replacement Item This antibody may replace item sc-271621 from Santa Cruz Biotechnology.
Immunogen The antiserum was produced against synthesized peptide derived from human FHIT.
Purification The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen.
Peptide Sequence Synthetic peptide located within the following region: FSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASW
Concentration 1mg/ml
Datasheets/Manuals Printable datasheet for OAAF07895
Specificity FHIT Antibody detects endogenous levels of FHIT.
Formulation Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application Info
IHC: 1:50~1:100
ELISA: 1:10000
Gene Symbol FHIT
Alias Symbols AP3A hydrolase, AP3AASE, Bis(5'-adenosyl)-triphosphatase, Bis(5'-adenosyl)-triphosphatease, Dinucleosidetriphosphatase, Fragile histidine triad protein
NCBI Gene Id 2272
Swissprot Id P49789
Molecular Weight 16 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FHIT.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FHIT.
Write Your Own Review
You're reviewing:FHIT Antibody (OAAF07895)
Your Rating