Size:100 ug
$299.00
In Stock
SKU
OAAF07895
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

OAAF07895-FITC Conjugated

OAAF07895-HRP Conjugated

OAAF07895-Biotin Conjugated

FHIT Antibody (OAAF07895)

Catalog#: OAAF07895
Domestic: within 1 week delivery  International: 1 week
More Information
Predicted Species Reactivity Human
Clonality Polyclonal
Host Rabbit
Application IHC
Reconstitution and Storage Stable at -20C for at least 1 year.
Replacement Item This antibody may replace item sc-271621 from Santa Cruz Biotechnology.
Immunogen The antiserum was produced against synthesized peptide derived from human FHIT.
Purification The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen.
Peptide Sequence Synthetic peptide located within the following region: FSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASW
Concentration 1mg/ml
Datasheets/Manuals Printable datasheet for OAAF07895
Specificity FHIT Antibody detects endogenous levels of FHIT.
Formulation Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application Info
IHC: 1:50~1:100
ELISA: 1:10000
Gene Symbol FHIT
Alias Symbols AP3A hydrolase, AP3AASE, Bis(5'-adenosyl)-triphosphatase, Bis(5'-adenosyl)-triphosphatease, Dinucleosidetriphosphatase, Fragile histidine triad protein
NCBI Gene Id 2272
Swissprot Id P49789
Molecular Weight 16 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FHIT.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FHIT.
  1. What is the species homology for "FHIT Antibody (OAAF07895)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "FHIT Antibody (OAAF07895)"?

    This item is available "Domestic: within 1 week delivery  International: 1 week".

  3. What buffer format is "FHIT Antibody (OAAF07895)" provided in?

    This item is provided in "".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FHIT Antibody (OAAF07895)"?

    This target may also be called "AP3A hydrolase, AP3AASE, Bis(5'-adenosyl)-triphosphatase, Bis(5'-adenosyl)-triphosphatease, Dinucleosidetriphosphatase, Fragile histidine triad protein" in publications.

  5. What is the shipping cost for "FHIT Antibody (OAAF07895)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FHIT Antibody (OAAF07895)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FHIT Antibody (OAAF07895)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "16 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FHIT Antibody (OAAF07895)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FHIT"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FHIT"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FHIT"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FHIT"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FHIT"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FHIT"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FHIT Antibody (OAAF07895)
Your Rating