Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP51169_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP51169_P050-FITC Conjugated

ARP51169_P050-HRP Conjugated

ARP51169_P050-Biotin Conjugated

FHIT Antibody - middle region (ARP51169_P050)

Catalog#: ARP51169_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-271621 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human FHIT
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 79%; Zebrafish: 86%
Complete computational species homology data ARP51169_P050
Peptide Sequence Synthetic peptide located within the following region: VHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYF
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide Catalog # AAP51169 (Previous Catalog # AAPP28040)
Datasheets/Manuals Printable datasheet for ARP51169_P050
Gene Symbol FHIT
Official Gene Full Name Fragile histidine triad
Alias Symbols AP3Aase, FRA3B
NCBI Gene Id 2272
Protein Name Bis(5'-adenosyl)-triphosphatase
Description of Target This gene, a member of the histidine triad gene family, encodes a diadenosine 5',5'''-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. Alternatively spliced transcript variants have been found for this gene.
Swissprot Id P49789
Protein Accession # NP_002003
Nucleotide Accession # NM_002012
Protein Size (# AA) 147
Molecular Weight 17
Tissue Tool Find tissues and cell lines supported by DNA array analysis
RNA Seq Find tissues and cell lines supported by RNA-seq analysis
Protein Interactions FHIT; REL; MDM2; UBC; RAB40B; TRIM23; LEF1; CTNNB1; UBE2I; SRC; GSN; HSPD1; FDXR;
Write Your Own Review
You're reviewing:FHIT Antibody - middle region (ARP51169_P050)
Your Rating