Size:100 ug
$379.00
In Stock
SKU
OAAF07895-HRP
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

OAAF07895 Unconjugated

OAAF07895-FITC Conjugated

OAAF07895-Biotin Conjugated

FHIT Antibody : HRP (OAAF07895-HRP)

Catalog#: OAAF07895-HRP
Domestic: within 1 week delivery  International: 1 week
More Information
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP
ApplicationIHC, ELISA
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement ItemThis antibody may replace item sc-271621 from Santa Cruz Biotechnology.
ImmunogenThe antiserum was produced against synthesized peptide derived from human FHIT.
PurificationThe antibody was purified from rabbit antiserum by affinity-chromatography using immunogen.
Peptide SequenceSynthetic peptide located within the following region: FSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASW
Concentration0.6-0.7 mg/ml
Datasheets/ManualsPrintable datasheet for OAAF07895-HRP
SpecificityFHIT Antibody detects endogenous levels of FHIT.
Application Info
IHC: 1:50~1:100
ELISA: 1:10000
Gene SymbolFHIT
Alias SymbolsAP3A hydrolase, AP3AASE, Bis(5'-adenosyl)-triphosphatase, Bis(5'-adenosyl)-triphosphatease, Dinucleosidetriphosphatase, Fragile histidine triad protein
NCBI Gene Id2272
Swissprot IdP49789
Molecular Weight16 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express FHIT.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express FHIT.
Write Your Own Review
You're reviewing:FHIT Antibody : HRP (OAAF07895-HRP)
Your Rating
Aviva Pathways
Aviva HIS tag Deal
Aviva Live Chat
Assay Development