Search Antibody, Protein, and ELISA Kit Solutions

FHIT Antibody - C-terminal region : FITC (ARP73859_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73859_P050 Unconjugated

ARP73859_P050-HRP Conjugated

ARP73859_P050-Biotin Conjugated

Gene Symbol:
FHIT
NCBI Gene Id:
2272
Swissprot Id:
P49789
Protein Accession #:
XP_005265010
Alias Symbols:
FHIT,
Replacement Item:
This antibody may replace item sc-271621 from Santa Cruz Biotechnology.
Description of Target:
This gene, a member of the histidine triad gene family, encodes a diadenosine 5',5'''-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. Alternatively spliced transcript variants have been found for this gene.
Protein Size (# AA):
147
Molecular Weight:
16kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FHIT.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FHIT.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FHIT
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: KHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAAL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
FHIT; REL; MDM2; UBC; RAB40B; TRIM23; LEF1; CTNNB1; UBE2I; SRC; GSN; HSPD1; FDXR;
Blocking Peptide:
For anti-FHIT (ARP73859_P050-FITC) antibody is Catalog # AAP73859
Datasheets/Manuals:
Printable datasheet for anti-FHIT (ARP73859_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...