Size:100 ul
$289.00
In Stock
SKU
ARP73859_P050-Biotin
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP73859_P050 Unconjugated

ARP73859_P050-FITC Conjugated

ARP73859_P050-HRP Conjugated

FHIT Antibody - C-terminal region : Biotin (ARP73859_P050-Biotin)

Catalog#: ARP73859_P050-Biotin
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Replacement ItemThis antibody may replace item sc-271621 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human FHIT
PurificationAffinity Purified
Peptide SequenceSynthetic peptide located within the following region: KHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAAL
Concentration0.5 mg/ml
Blocking PeptideFor anti-FHIT (ARP73859_P050-Biotin) antibody is Catalog # AAP73859
Datasheets/ManualsPrintable datasheet for anti-FHIT (ARP73859_P050-Biotin) antibody
Gene SymbolFHIT
Alias SymbolsFHIT,
NCBI Gene Id2272
Description of TargetThis gene, a member of the histidine triad gene family, encodes a diadenosine 5',5'''-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. Alternatively spliced transcript variants have been found for this gene.
Swissprot IdP49789
Protein Accession #XP_005265010
Protein Size (# AA)147
Molecular Weight16kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express FHIT.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express FHIT.
Protein InteractionsFHIT; REL; MDM2; UBC; RAB40B; TRIM23; LEF1; CTNNB1; UBE2I; SRC; GSN; HSPD1; FDXR;
  1. What is the species homology for "FHIT Antibody - C-terminal region : Biotin (ARP73859_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "FHIT Antibody - C-terminal region : Biotin (ARP73859_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FHIT Antibody - C-terminal region : Biotin (ARP73859_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FHIT Antibody - C-terminal region : Biotin (ARP73859_P050-Biotin)"?

    This target may also be called "FHIT, " in publications.

  5. What is the shipping cost for "FHIT Antibody - C-terminal region : Biotin (ARP73859_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FHIT Antibody - C-terminal region : Biotin (ARP73859_P050-Biotin)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "FHIT Antibody - C-terminal region : Biotin (ARP73859_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "16kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FHIT Antibody - C-terminal region : Biotin (ARP73859_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FHIT"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FHIT"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FHIT"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FHIT"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FHIT"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FHIT"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FHIT Antibody - C-terminal region : Biotin (ARP73859_P050-Biotin)
Your Rating
Aviva HIS tag Deal
Aviva Live Chat
Aviva Validation Data
Assay Development