FGR Antibody - N-terminal region (ARP76159_P050)

Catalog No: ARP76159_P050

Host: Rabbit
Target Name: FGR
Sample Tissue: Human Jurkat Whole Cell
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FGR
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: GDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIR
• Concentration: 0.5 mg/ml
• Blocking Peptide: Catalog # AAP76159

Target Info

• Gene Symbol: FGR
• Gene Full Name: FGR proto-oncogene, Src family tyrosine kinase
• Alias Symbols: SRC2, c-fgr, c-src2, p55-Fgr, p58-Fgr, p55c-fgr, p58c-fgr
• NCBI Gene Id: 2268
• Protein Name: tyrosine-protein kinase Fgr
• Description of Target: This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to plasma membrane ruffles, and functions as a negative regulator of cell migration and adhesion triggered by the beta-2 integrin signal transduction pathway. Infection with Epstein-Barr virus results in the overexpression of this gene. Multiple alternatively spliced variants, encoding the same protein, have been identified.
• Uniprot ID: P09769
• Protein Accession #: NP_001036194.1
• Nucleotide Accession #: NM_001042729.1
• Protein Size (# AA): 167
• Molecular Weight: 59 kDa