Search Antibody, Protein, and ELISA Kit Solutions

FGR Antibody - middle region (ARP54523_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP54523_P050-FITC Conjugated

ARP54523_P050-HRP Conjugated

ARP54523_P050-Biotin Conjugated

Gene Symbol:
FGR
Official Gene Full Name:
Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog
NCBI Gene Id:
2268
Protein Name:
Tyrosine-protein kinase Fgr
Swissprot Id:
P09769
Protein Accession #:
NP_001036194
Nucleotide Accession #:
NM_001042729
Alias Symbols:
FLJ43153, MGC75096, SRC2, c-fgr, c-src2, p55c-fgr, p58c-fgr, p55-Fgr, p58-Fgr
Replacement Item:
This antibody may replace item sc-130 from Santa Cruz Biotechnology.
Description of Target:
This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to plasma membrane ruffles, and functions as a negative regulator of cell migration and adhesion triggered by the beta-2 integrin signal transduction pathway. Infection with Epstein-Barr virus results in the overexpression of this gene. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Protein Size (# AA):
529
Molecular Weight:
59kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FGR.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FGR.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human FGR
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Guinea Pig: 83%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 92%; Rat: 93%; Zebrafish: 83%
Complete computational species homology data:
Anti-FGR (ARP54523_P050)
Peptide Sequence:
Synthetic peptide located within the following region: CPPGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
IKBKG; STAT3; HSP90AA1; ERBB2; NR1I2; UBC; DOK1; KHDRBS1; SYK; SH3KBP1; FASLG; INPP5D; SLAMF1; VDR; HCLS1; CCR3; DAB2; PTK2; CD24; WAS; SRC; CBL; FGR; SNCA; YWHAQ; CSK; ARRB1; NCOA6;
Blocking Peptide:
For anti-FGR (ARP54523_P050) antibody is Catalog # AAP54523 (Previous Catalog # AAPP41704)
Datasheets/Manuals:
Printable datasheet for anti-FGR (ARP54523_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...