Search Antibody, Protein, and ELISA Kit Solutions

FGL2 Antibody - middle region (ARP52235_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP52235_P050-FITC Conjugated

ARP52235_P050-HRP Conjugated

ARP52235_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-100276 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human FGL2
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-FGL2 (ARP52235_P050)
Peptide Sequence:
Synthetic peptide located within the following region: WTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMIL
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-FGL2 (ARP52235_P050) antibody is Catalog # AAP52235 (Previous Catalog # AAPP42443)
Datasheets/Manuals:
Printable datasheet for anti-FGL2 (ARP52235_P050) antibody
Publications:

Bongoni, AK; Klymiuk, N; Wolf, E; Ayares, D; Rieben, R; Cowan, PJ; Transgenic Expression of Human Thrombomodulin Inhibits HMGB1-Induced Porcine Aortic Endothelial Cell Activation. 100, 1871-9 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 27077599

Pischke, SE; Gustavsen, A; Orrem, HL; Egge, KH; Courivaud, F; Fontenelle, H; Despont, A; Bongoni, AK; Rieben, R; Tønnessen, TI; Nunn, MA; Scott, H; Skulstad, H; Barratt-Due, A; Mollnes, TE; Complement factor 5 blockade reduces porcine myocardial infarction size and improves immediate cardiac function. 112, 20 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 28258298

Gene Symbol:
FGL2
Official Gene Full Name:
Fibrinogen-like 2
Alias Symbols:
T49, pT49
NCBI Gene Id:
10875
Protein Name:
Fibroleukin
Description of Target:
The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites.
Swissprot Id:
Q14314
Protein Accession #:
NP_006673
Nucleotide Accession #:
NM_006682
Protein Size (# AA):
439
Molecular Weight:
48
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FGL2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FGL2.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...