Search Antibody, Protein, and ELISA Kit Solutions

FGL2 antibody - middle region (ARP52235_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP52235_P050-FITC Conjugated

ARP52235_P050-HRP Conjugated

ARP52235_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Fibrinogen-like 2
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
T49, pT49
Replacement Item:
This antibody may replace item sc-100276 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FGL2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FGL2.
The immunogen is a synthetic peptide directed towards the middle region of human FGL2
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-FGL2 (ARP52235_P050)
Peptide Sequence:
Synthetic peptide located within the following region: WTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMIL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-FGL2 (ARP52235_P050) antibody is Catalog # AAP52235 (Previous Catalog # AAPP42443)
Printable datasheet for anti-FGL2 (ARP52235_P050) antibody

Bongoni, AK; Klymiuk, N; Wolf, E; Ayares, D; Rieben, R; Cowan, PJ; Transgenic Expression of Human Thrombomodulin Inhibits HMGB1-Induced Porcine Aortic Endothelial Cell Activation. 100, 1871-9 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 27077599

Pischke, SE; Gustavsen, A; Orrem, HL; Egge, KH; Courivaud, F; Fontenelle, H; Despont, A; Bongoni, AK; Rieben, R; Tønnessen, TI; Nunn, MA; Scott, H; Skulstad, H; Barratt-Due, A; Mollnes, TE; Complement factor 5 blockade reduces porcine myocardial infarction size and improves immediate cardiac function. 112, 20 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 28258298

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...