Size:100 ul
$289.00
In Stock
SKU
ARP52235_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP52235_P050-FITC Conjugated

ARP52235_P050-HRP Conjugated

ARP52235_P050-Biotin Conjugated

FGL2 Antibody - middle region (ARP52235_P050)

Catalog#: ARP52235_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-100276 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human FGL2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology dataAnti-FGL2 (ARP52235_P050)
Peptide SequenceSynthetic peptide located within the following region: WTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMIL
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-FGL2 (ARP52235_P050) antibody is Catalog # AAP52235 (Previous Catalog # AAPP42443)
Datasheets/ManualsPrintable datasheet for anti-FGL2 (ARP52235_P050) antibody
Publications

Bongoni, AK; Klymiuk, N; Wolf, E; Ayares, D; Rieben, R; Cowan, PJ; Transgenic Expression of Human Thrombomodulin Inhibits HMGB1-Induced Porcine Aortic Endothelial Cell Activation. 100, 1871-9 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 27077599

Pischke, SE; Gustavsen, A; Orrem, HL; Egge, KH; Courivaud, F; Fontenelle, H; Despont, A; Bongoni, AK; Rieben, R; Tønnessen, TI; Nunn, MA; Scott, H; Skulstad, H; Barratt-Due, A; Mollnes, TE; Complement factor 5 blockade reduces porcine myocardial infarction size and improves immediate cardiac function. 112, 20 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 28258298

Gene SymbolFGL2
Official Gene Full NameFibrinogen-like 2
Alias SymbolsT49, pT49
NCBI Gene Id10875
Protein NameFibroleukin
Description of TargetThe protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites.
Swissprot IdQ14314
Protein Accession #NP_006673
Nucleotide Accession #NM_006682
Protein Size (# AA)439
Molecular Weight48
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express FGL2.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express FGL2.
Write Your Own Review
You're reviewing:FGL2 Antibody - middle region (ARP52235_P050)
Your Rating
Aviva Blast Tool
Aviva ChIP Antibodies
Aviva Tissue Tool
Aviva Travel Grant