FGFBP2 Antibody - C-terminal region : FITC (ARP60593_P050-FITC)

Catalog No: ARP60593_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FGFBP2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPFQALCAFLISFF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FGFBP2 (ARP60593_P050-FITC) antibody is Catalog # AAP60593 (Previous Catalog # AAPP46632)

Target Info

• Gene Symbol: FGFBP2
• Gene Full Name: Fibroblast growth factor binding protein 2
• Alias Symbols: KSP37, HBP17RP
• NCBI Gene Id: 83888
• Protein Name: Fibroblast growth factor-binding protein 2
• Description of Target: FGFBP2 is a member of the fibroblast growth factor binding protein family. The encoded protein is a serum protein that is selectively secreted by cytotoxic lymphocytes and may be involved in cytotoxic lymphocyte-mediated immunity. An increase in the amount of gene product may be associated with atopic asthma and mild extrinsic asthma.
• Uniprot ID: Q9BYJ0
• Protein Accession #: NP_114156
• Nucleotide Accession #: NM_031950
• Protein Size (# AA): 223
• Molecular Weight: 24kDa
• Protein Interactions: APP;