$0.00
In Stock
SKU
OPBG00125
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

FGFBP1 Recombinant Protein (Human) (OPBG00125)

Catalog#: OPBG00125
Domestic: within 1 week delivery | International: 1 week
More Information
Predicted Species Reactivity Human
Host E. Coli
Additional Information Verified by N-terminal and Mass Spectrometry analyses (when applicable).
Endotoxin level is <0.1 ng/ug of protein (<1EU/ug).
Reconstitution and Storage Store at -20C. Avoid freeze/thaw cycles.
Protein Sequence Synthetic peptide located within the following region:
PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Datasheets/Manuals Printable datasheet for OPBG00125
Gene Symbol FGFBP1
Official Gene Full Name fibroblast growth factor binding protein 1
Alias Symbols FGFBP, HBP17, FGF-BP, FGF-BP1, FGFBP-1
NCBI Gene Id 9982
Description of Target FGF-basic is one of 23 known members of the FGF family. Proteins of this family play a central role during prenatal development and postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-basic is a non-glycosylated heparin binding growth factor that is expressed in the brain, pituitary, kidney, retina, bone, testis, adrenal gland liver, monocytes, epithelial cells and endothelial cells. FGF-basic signals through FGFR 1b, 1c, 2c, 3c and 4. Recombinant Human FGF-basic (146 a.a.) is a 16.4 kDa protein consisting of 146 amino acid residues.
Swissprot Id Q14512
Protein Accession # NP_005121.1
Nucleotide Accession # NM_005130.4
Protein Size (# AA) 234
Molecular Weight 26 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FGFBP1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FGFBP1.
Write Your Own Review
You're reviewing:FGFBP1 Recombinant Protein (Human) (OPBG00125)
Your Rating