- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-FGF2 (ARP42005_P050) antibody |
---|
Publications | MicroRNA-205 mediates endothelial progenitor functions in distraction osteogenesis by targeting the transcription regulator NOTCH2. Stem Cell Res Ther. 12, 101 (2021). 335360581$s> | ||||
---|---|---|---|---|---|
Tested Species Reactivity | Human, Mouse | ||||
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish | ||||
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | ||||
Clonality | Polyclonal | ||||
Host | Rabbit | ||||
Application | IHC, WB | ||||
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. | ||||
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human FGF2 | ||||
Purification | Affinity Purified | ||||
Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 86% | ||||
Peptide Sequence | Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS | ||||
Concentration | 0.5 mg/ml | ||||
Blocking Peptide | For anti-FGF2 (ARP42005_P050) antibody is Catalog # AAP42005 (Previous Catalog # AAPS11410) | ||||
Enhanced Validation |
|
Reference | Goodger,S.J., (2008) J. Biol. Chem. 283 (19), 13001-13008 |
---|---|
Gene Symbol | FGF2 |
Gene Full Name | Fibroblast growth factor 2 (basic) |
Alias Symbols | BFGF, FGFB, FGF-2, HBGF-2 |
NCBI Gene Id | 2247 |
Protein Name | Fibroblast growth factor 2 |
Description of Target | The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors.The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members bind heparin and possess broad mitogenic and angiogenic activities. This protein has been implicated in diverse biological processes, such as limb and nervous system development, wound healing, and tumor growth. The mRNA for this gene contains multiple polyadenylation sites, and is alternatively translated from non-AUG (CUG) and AUG initiation codons, resulting in five different isoforms with distinct properties. The CUG-initiated isoforms are localized in the nucleus and are responsible for the intracrine effect, whereas, the AUG-initiated form is mostly cytosolic and is responsible for the paracrine and autocrine effects of this FGF. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Uniprot ID | P09038 |
Protein Accession # | NP_001997 |
Nucleotide Accession # | NM_002006 |
Protein Size (# AA) | 288 |
Molecular Weight | 31 kDa |
Protein Interactions | TUBG1; HMT1; PRMT1; CRYAB; THBS1; UBC; API5; CEP57; FGFRL1; FGFBP1; CXCL13; RPL6; RPS19; PTX3; NRP1; GPC4; RPS6KA3; GPC3; VTN; SDC3; SDC1; PF4; HSPG2; SDC2; FGFR1; FGFR4; FGFR3; FGF2; CSNK2A2; CSNK2B; CSNK2A1; CD44; SDC4; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "FGF2 Antibody - middle region (ARP42005_P050)"?
The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish".
-
How long will it take to receive "FGF2 Antibody - middle region (ARP42005_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "FGF2 Antibody - middle region (ARP42005_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "FGF2 Antibody - middle region (ARP42005_P050)"?
This target may also be called "BFGF, FGFB, FGF-2, HBGF-2" in publications.
-
What is the shipping cost for "FGF2 Antibody - middle region (ARP42005_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "FGF2 Antibody - middle region (ARP42005_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "FGF2 Antibody - middle region (ARP42005_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "31 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "FGF2 Antibody - middle region (ARP42005_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "FGF2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "FGF2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "FGF2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "FGF2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "FGF2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "FGF2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.