Search Antibody, Protein, and ELISA Kit Solutions

FGF12 Antibody - C-terminal region (ARP84947_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
FGF12
Official Gene Full Name:
fibroblast growth factor 12
NCBI Gene Id:
2257
Protein Name:
fibroblast growth factor 12
Swissprot Id:
P61328-2
Protein Accession #:
NP_004104.3
Nucleotide Accession #:
NM_004113.5
Alias Symbols:
FHF1, FGF12B
Description of Target:
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This growth factor lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. Two alternatively spliced transcript variants encoding distinct isoforms have been reported.
Protein Size (# AA):
181
Molecular Weight:
20 kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FGF12.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FGF12.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human FGF12
Peptide Sequence:
Synthetic peptide located within the following region: TKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQD
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-FGF12 (ARP84947_P050) antibody is Catalog # AAP84947
Datasheets/Manuals:
Printable datasheet for anti-FGF12 (ARP84947_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...