Catalog No: OPPA00733 (Formerly GWB-CC7F5A)
Size:5UG
Price: $75.00
SKU
OPPA00733
Availability: Domestic: within 1-2 weeks delivery | International: 1-2 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for OPPA00733 |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | Lyophilized. PBS, pH 7.4 Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder |
Host | E. Coli |
Reconstitution and Storage | It is recommended to reconstitute the lyophilized Fibroblast Growth Factor-21 Human Recombinant sterile 18M Omega -cm H2O not less than 100 ug/ml, which can then be further diluted to other aqueous solutions. Lyophilized FGF-21 Human Recombinant, although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution, Fibroblast Growth Factor 21 should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
Purification | The FGF-21 is purified by proprietary chromatographic techniques. |
Purity | Greater than 95.0% as determined by SDS-PAGE. |
Biological Activity | The ED50 as determined by the dose dependent stimulation of the proliferation of BAF3 cells expressing FGF receptors is 0.06-0.4 ug/ml in the presence of beta-Klotho and Heparin. |
Peptide Sequence | MHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS. |
Gene Symbol | FGF 21 |
---|---|
Alias Symbols | Fibroblast growth factor 21, FGF-21, FGF 21 Human, Fibroblast Growth Factor-21 Human Recombinant |
NCBI Gene Id | 26291 |
Protein Name | Fibroblast growth factor 21 |
Description of Target | Fibroblast Growth Factor -21 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 182 amino acids and an N-terminal Methionin. The FGFs are a family of more than 20 small (~17–26 kDa) secreted peptides. The initial characterization of these proteins focused on their ability to stimulate fibroblast proliferation. This mitogenic activity was mediated through FGF receptors (FGFRs) 1, 2, or 3. A fourth closely related tyrosine kinase receptor (FGFR4) was able to bind the FGFs but did not lead to a mitogenic response. FGFs modulate cellular activity via at least 5 distinct subfamilies of high-affinity FGF receptors (FGFRs): FGFR-1, -2, -3, and -4, all with intrinsic tyrosine kinase activity and, except for FGFR-4, multiple splice isoforms, and FGFR-5, which lacks an intracellular kinase domain. There is growing evidence that FGFRs can be important for regulation of glucose and lipid homeostasis. The overexpression of a dominant negative form of FGFR-1 in cells leads to diabetes in mice, which thus implies that proper FGF signaling is required for normal cell function and glycemia maintenance. FGFR-2 appears to be a key molecule during pancreatic development. Moreover, FGFR-4 has been implicated in cholesterol metabolism and bile acid synthesis. FGF-19, has been shown to cause resistance to diet-induced obesity and insulin desensitization and to improve insulin, glucose, and lipid profiles in diabetic rodents. Since these effects, at least in part, are mediated through the observed changes in metabolic rates, FGF-19 can be considered as a regulator of energy expenditure. FGF-21 is preferentially expressed in liver, but an exact knowledge of FGF-21 bioactivity and its mode of action have been lacking to date. FGF-21 is a potent activator of glucose uptake on adipocytes, protects animals from diet-induced obesity when overexpressed in transgenic mice, and lowers blood glucose and triglyceride levels when therapeutically administered to diabetic rodents. |
Uniprot ID | Q9NSA1 |
Protein Accession # | NP_061986.1 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 19.5 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review