SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP62387_P050
Price: $0.00
SKU
ARP62387_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-FGD3 (ARP62387_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Horse: 85%; Human: 100%; Mouse: 86%; Pig: 85%; Rabbit: 79%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: STSPVEPVVTTEGSSGAAGLEPRKLSSKTRRDKEKQSCKSCGETFNSITK
Concentration0.5 mg/ml
Blocking PeptideFor anti-FGD3 (ARP62387_P050) antibody is Catalog # AAP62387
Gene SymbolFGD3
Gene Full NameFYVE, RhoGEF and PH domain containing 3
Alias SymbolsZFYVE5
NCBI Gene Id89846
Protein NameFYVE, RhoGEF and PH domain-containing protein 3
Description of TargetFGD3 promotes the formation of filopodia. It may activate CDC42, a member of the Ras-like family of Rho- and Rac proteins, by exchanging bound GDP for free GTP. FGD3 plays a role in regulating the actin cytoskeleton and cell shape.
Uniprot IDQ5JSP0-2
Protein Accession #NP_149077
Nucleotide Accession #NM_033086
Protein Size (# AA)634
Molecular Weight70kDa
Protein InteractionsBTRC; UBC; CDC42;
  1. What is the species homology for "FGD3 Antibody - middle region (ARP62387_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Horse, Pig, Rabbit".

  2. How long will it take to receive "FGD3 Antibody - middle region (ARP62387_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FGD3 Antibody - middle region (ARP62387_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FGD3 Antibody - middle region (ARP62387_P050)"?

    This target may also be called "ZFYVE5" in publications.

  5. What is the shipping cost for "FGD3 Antibody - middle region (ARP62387_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FGD3 Antibody - middle region (ARP62387_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FGD3 Antibody - middle region (ARP62387_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "70kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FGD3 Antibody - middle region (ARP62387_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "FGD3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FGD3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FGD3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FGD3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FGD3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FGD3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FGD3 Antibody - middle region (ARP62387_P050)
Your Rating