SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP31673_P050
Price: $0.00
SKU
ARP31673_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-FGD1 (ARP31673_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human FGD1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 86%; Horse: 79%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 79%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: WMAVLGRAGRGDTFCPGPTLSEDREMEEAPVAALGATAEPPESPQTRDKT
Concentration0.5 mg/ml
Blocking PeptideFor anti-FGD1 (ARP31673_P050) antibody is Catalog # AAP31673 (Previous Catalog # AAPP02460)
Sample Type Confirmation

FGD1 is supported by BioGPS gene expression data to be expressed in Raji

ReferenceLebel,R.R., et al., (2002) Clin. Genet. 61 (2), 139-145
Gene SymbolFGD1
Gene Full NameFYVE, RhoGEF and PH domain containing 1
Alias SymbolsAAS, FGDY, MRXS16, ZFYVE3
NCBI Gene Id2245
Protein NameFYVE, RhoGEF and PH domain-containing protein 1
Description of TargetFGD1 contains Dbl (DH) and pleckstrin (PH) homology domains. It can bind specifically to the Rho family GTPase Cdc42Hs and stimulate the GDP-GTP exchange of the isoprenylated form of Cdc42Hs. It also stimulates the mitogen activated protein kinase cascade leading to c-Jun kinase SAPK/JNK1 activation. FGD1 has an essential role in embryonic development, and FGD1 gene mutations result in the human developmental disorder, Aarskog-Scott syndrome.
Uniprot IDP98174
Protein Accession #NP_004454
Nucleotide Accession #NM_004463
Protein Size (# AA)961
Molecular Weight107kDa
Protein InteractionsBTRC; UBC; ELAVL1; ELMO1; CTTN; CDC42; AOC1;
  1. What is the species homology for "FGD1 Antibody - C-terminal region (ARP31673_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit".

  2. How long will it take to receive "FGD1 Antibody - C-terminal region (ARP31673_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FGD1 Antibody - C-terminal region (ARP31673_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FGD1 Antibody - C-terminal region (ARP31673_P050)"?

    This target may also be called "AAS, FGDY, MRXS16, ZFYVE3" in publications.

  5. What is the shipping cost for "FGD1 Antibody - C-terminal region (ARP31673_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FGD1 Antibody - C-terminal region (ARP31673_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FGD1 Antibody - C-terminal region (ARP31673_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "107kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FGD1 Antibody - C-terminal region (ARP31673_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "FGD1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FGD1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FGD1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FGD1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FGD1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FGD1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FGD1 Antibody - C-terminal region (ARP31673_P050)
Your Rating
We found other products you might like!