Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP41759_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41759_P050-FITC Conjugated

ARP41759_P050-HRP Conjugated

ARP41759_P050-Biotin Conjugated

FGA Antibody - middle region (ARP41759_P050)

Catalog#: ARP41759_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-166968 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human FGA
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%
Complete computational species homology data Anti-FGA (ARP41759_P050)
Peptide Sequence Synthetic peptide located within the following region: SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FGA (ARP41759_P050) antibody is Catalog # AAP41759 (Previous Catalog # AAPP10807)
Datasheets/Manuals Printable datasheet for anti-FGA (ARP41759_P050) antibody
Target Reference Jood,K., (2008) J. Thromb. Haemost. 6 (6), 897-904
Publications

Matsumoto, M. et al. An efficient system for secretory production of fibrinogen using a hepatocellular carcinoma cell line. Hepatol. Res. 45, 315-25 (2015). WB, Human 24802089

Prieto-García, A. et al. Mast cell restricted mouse and human tryptase·heparin complexes hinder thrombin-induced coagulation of plasma and the generation of fibrin by proteolytically destroying fibrinogen. J. Biol. Chem. 287, 7834-44 (2012). WB, Human 22235124

Gene Symbol FGA
Official Gene Full Name Fibrinogen alpha chain
Alias Symbols Fib2, MGC119422, MGC119423, MGC119425
NCBI Gene Id 2243
Protein Name Fibrinogen alpha chain
Description of Target FGA is the alpha component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in its gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis. The protein encoded by this gene is the alpha component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis. Alternative splicing results in two isoforms which vary in the carboxy-terminus.
Swissprot Id Q4QQH7
Protein Accession # NP_068657
Nucleotide Accession # NM_021871
Protein Size (# AA) 644
Molecular Weight 66kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FGA.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FGA.
Protein Interactions ASB7; ASB6; FN1; APOA1; ALB; UBC; SUMO2; MIS12; KHDRBS2; ITGA2B; SERPINA5; CDH5; SERPINF2; THBS1; F2; ITGB3; PLAT; HRG; PRRC2A; FGG; FGB; FGA; F13A1; NID1;
Write Your Own Review
You're reviewing:FGA Antibody - middle region (ARP41759_P050)
Your Rating