Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP41759_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41759_P050-FITC Conjugated

ARP41759_P050-HRP Conjugated

ARP41759_P050-Biotin Conjugated

FGA Antibody - middle region (ARP41759_P050)

Catalog#: ARP41759_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-166968 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human FGA
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%
Complete computational species homology data Anti-FGA (ARP41759_P050)
Peptide Sequence Synthetic peptide located within the following region: SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAK
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FGA (ARP41759_P050) antibody is Catalog # AAP41759 (Previous Catalog # AAPP10807)
Datasheets/Manuals Printable datasheet for anti-FGA (ARP41759_P050) antibody
Target Reference Jood,K., (2008) J. Thromb. Haemost. 6 (6), 897-904
Publications

Matsumoto, M. et al. An efficient system for secretory production of fibrinogen using a hepatocellular carcinoma cell line. Hepatol. Res. 45, 315-25 (2015). WB, Human 24802089

Prieto-García, A. et al. Mast cell restricted mouse and human tryptase·heparin complexes hinder thrombin-induced coagulation of plasma and the generation of fibrin by proteolytically destroying fibrinogen. J. Biol. Chem. 287, 7834-44 (2012). WB, Human 22235124

Gene Symbol FGA
Official Gene Full Name Fibrinogen alpha chain
Alias Symbols Fib2, MGC119422, MGC119423, MGC119425
NCBI Gene Id 2243
Protein Name Fibrinogen alpha chain
Description of Target FGA is the alpha component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in its gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis. The protein encoded by this gene is the alpha component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis. Alternative splicing results in two isoforms which vary in the carboxy-terminus.
Swissprot Id Q4QQH7
Protein Accession # NP_068657
Nucleotide Accession # NM_021871
Protein Size (# AA) 644
Molecular Weight 66kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FGA.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FGA.
Protein Interactions ASB7; ASB6; FN1; APOA1; ALB; UBC; SUMO2; MIS12; KHDRBS2; ITGA2B; SERPINA5; CDH5; SERPINF2; THBS1; F2; ITGB3; PLAT; HRG; PRRC2A; FGG; FGB; FGA; F13A1; NID1;
  1. What is the species homology for "FGA Antibody - middle region (ARP41759_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "FGA Antibody - middle region (ARP41759_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FGA Antibody - middle region (ARP41759_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FGA Antibody - middle region (ARP41759_P050)"?

    This target may also be called "Fib2, MGC119422, MGC119423, MGC119425" in publications.

  5. What is the shipping cost for "FGA Antibody - middle region (ARP41759_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FGA Antibody - middle region (ARP41759_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FGA Antibody - middle region (ARP41759_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "66kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FGA Antibody - middle region (ARP41759_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FGA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FGA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FGA"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FGA"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FGA"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FGA"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FGA Antibody - middle region (ARP41759_P050)
Your Rating
We found other products you might like!