Search Antibody, Protein, and ELISA Kit Solutions

FES Antibody - N-terminal region (ARP54608_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP54608_P050-FITC Conjugated

ARP54608_P050-HRP Conjugated

ARP54608_P050-Biotin Conjugated

Gene Symbol:
FES
Official Gene Full Name:
Feline sarcoma oncogene
NCBI Gene Id:
2242
Protein Name:
Tyrosine-protein kinase Fes/Fps
Swissprot Id:
P07332
Protein Accession #:
NP_001996
Nucleotide Accession #:
NM_002005
Alias Symbols:
FPS
Replacement Item:
This antibody may replace item sc-114396 from Santa Cruz Biotechnology.
Description of Target:
FES is the human cellular counterpart of a feline sarcoma retrovirus protein with transforming capabilities. FES has tyrosine-specific protein kinase activity and that activity is required for maintenance of cellular transformation. Its chromosomal location has linked it to a specific translocation event identified in patients with acute promyelocytic leukemia but it is also involved in normal hematopoiesis. This gene encodes the human cellular counterpart of a feline sarcoma retrovirus protein with transforming capabilities. The gene product has tyrosine-specific protein kinase activity and that activity is required for maintenance of cellular transformation. Its chromosomal location has linked it to a specific translocation event identified in patients with acute promyelocytic leukemia but it is also involved in normal hematopoiesis. A truncated transcript has been identified that is generated utilizing a start site in one of the far downstream exons but a protein product associated with this transcript has not been identified. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
822
Molecular Weight:
93kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FES.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FES.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human FES
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 88%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Complete computational species homology data:
Anti-FES (ARP54608_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MDFI; HSP90AA1; EGFR; UBC; TRIM28; POT1; TERF1; NEDD4; ZNF775; ZNF746; PDE4DIP; HSH2D; PLXNA1; DPYSL5; RASA3; BCAR1; DOK1; IRS2; JAK3; FES; PIK3R1; BCR; JAK2; JAK1; IL4R; IRS1; RASA1; CSF2RB; STAT3; PTGES3; PPID; HSPA4; FKBP5; FKBP4; PSMD13;
Blocking Peptide:
For anti-FES (ARP54608_P050) antibody is Catalog # AAP54608 (Previous Catalog # AAPP31392)
Datasheets/Manuals:
Printable datasheet for anti-FES (ARP54608_P050) antibody
Target Reference:
Naba,A., (2008) EMBO J. 27 (1), 38-50

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...