Search Antibody, Protein, and ELISA Kit Solutions

FERMT1 Antibody - N-terminal region (ARP42485_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP42485_P050-FITC Conjugated

ARP42485_P050-HRP Conjugated

ARP42485_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human FERMT1
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Horse: 86%; Human: 100%; Rabbit: 93%; Rat: 79%
Complete computational species homology data:
Anti-FERMT1 (ARP42485_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQIN
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-FERMT1 (ARP42485_P050) antibody is Catalog # AAP42485 (Previous Catalog # AAPS12811)
Datasheets/Manuals:
Printable datasheet for anti-FERMT1 (ARP42485_P050) antibody
Target Reference:
Martignago,B.C., (2007) Br. J. Dermatol. 157 (6), 1281-1284
Gene Symbol:
FERMT1
Official Gene Full Name:
Fermitin family member 1
Alias Symbols:
C20orf42, DTGCU2, FLJ20116, FLJ23423, KIND1, URP1, unc112a, UNC112A
NCBI Gene Id:
55612
Protein Name:
Fermitin family homolog 1
Description of Target:
FERMT1 is involved in cell adhesion, possibly via its interaction with integrins. It may mediate TGF-beta 1 signaling in tumor progression. Defects in FERMT1 are the cause of Kindler syndrome.
Swissprot Id:
Q9BQL6
Protein Accession #:
NP_060141
Nucleotide Accession #:
NM_017671
Protein Size (# AA):
677
Molecular Weight:
77kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FERMT1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FERMT1.
Protein Interactions:
SRPK1;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...