Search Antibody, Protein, and ELISA Kit Solutions

FEN1 Antibody - N-terminal region (ARP46096_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP46096_P050-FITC Conjugated

ARP46096_P050-HRP Conjugated

ARP46096_P050-Biotin Conjugated

Gene Symbol:
FEN1
Official Gene Full Name:
Flap structure-specific endonuclease 1
NCBI Gene Id:
2237
Protein Name:
Flap endonuclease 1
Swissprot Id:
P39748
Protein Accession #:
NP_004102
Nucleotide Accession #:
NM_004111
Alias Symbols:
FEN-1, MF1, RAD2
Replacement Item:
This antibody may replace item sc-13051 from Santa Cruz Biotechnology.
Description of Target:
FEN1 removes 5' overhanging flaps in DNA repair and processes the 5' ends of Okazaki fragments in lagging strand DNA synthesis. Direct physical interaction between this protein and AP endonuclease 1 during long-patch base excision repair provides coordinated loading of the proteins onto the substrate, thus passing the substrate from one enzyme to another. The protein is a member of the XPG/RAD2 endonuclease family and is one of ten proteins essential for cell-free DNA replication. DNA secondary structure can inhibit flap processing at certain trinucleotide repeats in a length-dependent manner by concealing the 5' end of the flap that is necessary for both binding and cleavage by the protein encoded by this gene. Therefore, secondary structure can deter the protective function of this protein, leading to site-specific trinucleotide expansions.
Protein Size (# AA):
380
Molecular Weight:
42kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FEN1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FEN1.
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-FEN1 (ARP46096_P050)
Peptide Sequence:
Synthetic peptide located within the following region: APSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
SUMO2; SUMO3; PCNA; UBC; SHFM1; ELAC2; TNPO3; PPP2R5D; HARS; LPP; PFDN1; WRN; AICDA; RAD1; FN1; PAXIP1; APP; VRK1; RAP1A; cdt1; TERF1; RAD21; GSK3B; ENDOG; DDX11; NCAPG; EP300; BLM; EEF1G; ARHGDIA; HNRNPA1; CDK2; CDK1; APEX1; RAD9A; HUS1; CCNA2;
Blocking Peptide:
For anti-FEN1 (ARP46096_P050) antibody is Catalog # AAP46096
Datasheets/Manuals:
Printable datasheet for anti-FEN1 (ARP46096_P050) antibody
Sample Type Confirmation:

FEN1 is supported by BioGPS gene expression data to be expressed in HEK293T

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...