FECH Antibody - N-terminal region : HRP (ARP41682_T100-HRP)

Catalog No: ARP41682_T100-HRP

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FECH
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: LDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGM
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FECH (ARP41682_T100-HRP) antibody is Catalog # AAP41682 (Previous Catalog # AAPP24325)
• Sample Type Confirmation:

  FECH is strongly supported by BioGPS gene expression data to be expressed in Jurkat

• Reference: Maruyama,K. (2005) Blood 106 (3), 1098-1104
• Publications:

  Miyake, M. et al. siRNA-mediated knockdown of the heme synthesis and degradation pathways: modulation of treatment effect of 5-aminolevulinic acid-based photodynamic therapy in urothelial cancer cell lines. Photochem. Photobiol. 85, 1020-7 WB, Pig, Rat, Dog, Horse, Rabbit, Guinea pig, Human, Bovine, Mouse, Zebrafish, Yeast 19320847

Target Info

• Gene Symbol: FECH
• Gene Full Name: Ferrochelatase
• Alias Symbols: EPP, FCE, EPP1
• NCBI Gene Id: 2235
• Protein Name: Ferrochelatase, mitochondrial
• Description of Target: Ferrochelatase is localized to the mitochondrion where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Defects in ferrochelatase are associated with protoporphyria.Ferrochelatase is localized to the mitochondrion where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Defects in ferrochelatase are associated with protoporphyria. Two transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: Q8NAN0
• Protein Accession #: NP_001012533
• Nucleotide Accession #: NM_001012515
• Protein Size (# AA): 429
• Molecular Weight: 47kDa
• Protein Interactions: PPP2R1A; UBC; NEDD8; MDM2; FBXO6; gag-pol; COPS5; COPS6; CUL3; ELAVL1; MINOS1; MME; USP42; USP20; ABCB7; FECH;