Size:100 ul
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41682_T100-FITC Conjugated

ARP41682_T100-HRP Conjugated

ARP41682_T100-Biotin Conjugated

FECH Antibody - N-terminal region (ARP41682_T100)

80% of 100
Catalog#: ARP41682_T100
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FECH
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 86%
Complete computational species homology data Anti-FECH (ARP41682_T100)
Peptide Sequence Synthetic peptide located within the following region: LDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGM
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FECH (ARP41682_T100) antibody is Catalog # AAP41682 (Previous Catalog # AAPP24325)
Datasheets/Manuals Printable datasheet for anti-FECH (ARP41682_T100) antibody
Sample Type Confirmation

FECH is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference Maruyama,K. (2005) Blood 106 (3), 1098-1104

Miyake, M. et al. siRNA-mediated knockdown of the heme synthesis and degradation pathways: modulation of treatment effect of 5-aminolevulinic acid-based photodynamic therapy in urothelial cancer cell lines. Photochem. Photobiol. 85, 1020-7 (2009). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish 19320847

Gene Symbol FECH
Official Gene Full Name Ferrochelatase
Alias Symbols EPP, FCE
NCBI Gene Id 2235
Protein Name Ferrochelatase, mitochondrial
Description of Target Ferrochelatase is localized to the mitochondrion where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Defects in ferrochelatase are associated with protoporphyria.Ferrochelatase is localized to the mitochondrion where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Defects in ferrochelatase are associated with protoporphyria. Two transcript variants encoding different isoforms have been found for this gene.
Swissprot Id Q8NAN0
Protein Accession # NP_001012533
Nucleotide Accession # NM_001012515
Protein Size (# AA) 429
Molecular Weight 47kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FECH.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FECH.
Protein Interactions PPP2R1A; UBC; NEDD8; MDM2; FBXO6; gag-pol; COPS5; COPS6; CUL3; ELAVL1; MINOS1; MME; USP42; USP20; ABCB7; FECH;
  1. What is the species homology for "FECH Antibody - N-terminal region (ARP41682_T100)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish".

  2. How long will it take to receive "FECH Antibody - N-terminal region (ARP41682_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FECH Antibody - N-terminal region (ARP41682_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "FECH Antibody - N-terminal region (ARP41682_T100)"?

    This target may also be called "EPP, FCE" in publications.

  5. What is the shipping cost for "FECH Antibody - N-terminal region (ARP41682_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FECH Antibody - N-terminal region (ARP41682_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FECH Antibody - N-terminal region (ARP41682_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "47kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FECH Antibody - N-terminal region (ARP41682_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FECH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FECH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FECH"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FECH"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FECH"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FECH"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FECH Antibody - N-terminal region (ARP41682_T100)
Your Rating
We found other products you might like!