Size:20ug
$439.00
In Stock
SKU
OPCA03638
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

FCGRT Recombinant Protein (OPCA03638)

Catalog#: OPCA03638
Domestic: within 4-6 weeks delivery | International: 4-6 weeks
More Information
Product Format Liquid
Host Human
Additional Information Relevance: Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the uptake of IgG from milk. Possible role in transfer of immunoglobulin G from mother to fetus.
Reconstitution and Storage Store at -20C. Avoid freeze thaw cycles.
Formulation 20 mM Tris-HCl based buffer, pH 8.0
Purity Greater than 90% as determined by SDS-PAGE.
Protein Sequence AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS
Storage Buffer 20 mM Tris-HCl based buffer, pH 8.0
Source Mammalian cell
Tag N-terminal 6xHis-tagged
Target Reference A major histocompatibility complex class I-like Fc receptor cloned from human placenta
possible role in transfer of immunoglobulin G from mother to fetus.Story C.M., Mikulska J., Simister N.E.J. Exp. Med. 180:2377-2381(1994)
Partial sequence of the human fcgrt gene and its 5' upstream region.Tiwari B., Junghans R.P.Cloning and analysis of the gene encoding the human neonatal Fc receptor.Mikulska J.E., Pablo L., Canel J., Simister N.E.Eur. J. Immunogenet. 27:231-240(2000)
The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007)
Datasheets/Manuals Printable datasheet for FCGRT Recombinant Protein (Human) (OPCA03638)
Gene Symbol FCGRT
Official Gene Full Name IgG receptor FcRn large subunit p51
Alias Symbols FCRN, alpha-chain
NCBI Gene Id 2217
Protein Name IgG receptor FcRn large subunit p51
Description of Target This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants.
Swissprot Id P55899
Protein Accession # NP_001129491.1
Nucleotide Accession # NM_001136019.2
Molecular Weight 35 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FCGRT.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FCGRT.
Write Your Own Review
You're reviewing:FCGRT Recombinant Protein (OPCA03638)
Your Rating