Search Antibody, Protein, and ELISA Kit Solutions

FCGRT Recombinant Protein (OPCA03638)

20ug
$439.00
In Stock
Request Bulk Order Quote

Gene Symbol:
FCGRT
Official Gene Full Name:
IgG receptor FcRn large subunit p51
Alias Symbols:
FCRN, alpha-chain
NCBI Gene Id:
2217
Swissprot Id:
P55899
Protein Accession #:
NP_001129491.1
Nucleotide Accession #:
NM_001136019.2
Protein Name:
IgG receptor FcRn large subunit p51
Description of Target:
This gene encodes a receptor that binds the Fc region of monomeric immunoglobulin G. The encoded protein transfers immunoglobulin G antibodies from mother to fetus across the placenta. This protein also binds immunoglobulin G to protect the antibody from degradation. Alternative splicing results in multiple transcript variants.
Host:
Human
Molecular Weight:
35 kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FCGRT.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FCGRT.
Product Format:
Liquid
Formulation:
20 mM Tris-HCl based buffer, pH 8.0
Purity:
Greater than 90% as determined by SDS-PAGE.
Protein Sequence:
AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELGPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKSS
Storage Buffer:
20 mM Tris-HCl based buffer, pH 8.0
Source:
Mammalian cell
Additional Information:
Relevance: Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the uptake of IgG from milk. Possible role in transfer of immunoglobulin G from mother to fetus.
Tag:
N-terminal 6xHis-tagged
Reconstitution and Storage:
Store at -20C. Avoid freeze thaw cycles.
Target Reference:
A major histocompatibility complex class I-like Fc receptor cloned from human placenta
possible role in transfer of immunoglobulin G from mother to fetus.Story C.M., Mikulska J., Simister N.E.J. Exp. Med. 180:2377-2381(1994)
Partial sequence of the human fcgrt gene and its 5' upstream region.Tiwari B., Junghans R.P.Cloning and analysis of the gene encoding the human neonatal Fc receptor.Mikulska J.E., Pablo L., Canel J., Simister N.E.Eur. J. Immunogenet. 27:231-240(2000)
The full-ORF clone resource of the German cDNA consortium.Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.BMC Genomics 8:399-399(2007)
Datasheets/Manuals:
Printable datasheet for FCGRT Recombinant Protein (Human) (OPCA03638)

Product Reviews

Protocol:
Tips Information:

Tell us what you think about this item!

Write A Review
    Please, wait...