Size:100 ul
$319.00
In stock
SKU
ARP46406_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP46406_P050-FITC Conjugated

ARP46406_P050-HRP Conjugated

ARP46406_P050-Biotin Conjugated

FCGRT Antibody - N-terminal region (ARP46406_P050)

Catalog#: ARP46406_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-126843, HPA012122, HPA015130
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human FCGRT
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Dog: 79%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 79%; Sheep: 79%
Complete computational species homology dataAnti-FCGRT (ARP46406_P050)
Peptide SequenceSynthetic peptide located within the following region: GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-FCGRT (ARP46406_P050) antibody is Catalog # AAP46406 (Previous Catalog # AAPP27189)
Datasheets/ManualsPrintable datasheet for anti-FCGRT (ARP46406_P050) antibody
Sample Type Confirmation

FCGRT is supported by BioGPS gene expression data to be expressed in HepG2

Subunitp51
Target ReferenceCianga,P., (2007) Virchows Arch. 451 (4), 859-860
Gene SymbolFCGRT
Official Gene Full NameFc fragment of IgG, receptor, transporter, alpha
Alias SymbolsFCRN, alpha-chain
NCBI Gene Id2217
Protein NameIgG receptor FcRn large subunit p51
Description of TargetFCGRT binds to the Fc region of monomeric immunoglobulins gamma. It mediates the uptake of IgG from milk. It plays a possible role in transfer of immunoglobulin G from mother to fetus.
Swissprot IdP55899
Protein Accession #NP_004098
Nucleotide Accession #NM_004107
Protein Size (# AA)365
Molecular Weight40kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express FCGRT.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express FCGRT.
Protein InteractionsATG16L1; FCGRT; CA6; B2M; ALB;
Write Your Own Review
You're reviewing:FCGRT Antibody - N-terminal region (ARP46406_P050)
Your Rating
Aviva Live Chat
Aviva Validation Data
Aviva Blast Tool
Assay Development