Search Antibody, Protein, and ELISA Kit Solutions

FCGRT Antibody - N-terminal region (ARP46406_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP46406_P050-FITC Conjugated

ARP46406_P050-HRP Conjugated

ARP46406_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
Fc fragment of IgG, receptor, transporter, alpha
NCBI Gene Id:
Protein Name:
IgG receptor FcRn large subunit p51
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FCRN, alpha-chain
Replacement Item:
This antibody may replace item sc-126843, HPA012122, HPA015130
Description of Target:
FCGRT binds to the Fc region of monomeric immunoglobulins gamma. It mediates the uptake of IgG from milk. It plays a possible role in transfer of immunoglobulin G from mother to fetus.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FCGRT.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FCGRT.
The immunogen is a synthetic peptide directed towards the N terminal region of human FCGRT
Predicted Homology Based on Immunogen Sequence:
Cow: 79%; Dog: 79%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 79%; Sheep: 79%
Complete computational species homology data:
Anti-FCGRT (ARP46406_P050)
Peptide Sequence:
Synthetic peptide located within the following region: GWLGPQQYLSYNSLRGEAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLE
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FCGRT (ARP46406_P050) antibody is Catalog # AAP46406 (Previous Catalog # AAPP27189)
Printable datasheet for anti-FCGRT (ARP46406_P050) antibody
Sample Type Confirmation:

FCGRT is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Cianga,P., (2007) Virchows Arch. 451 (4), 859-860

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...