Search Antibody, Protein, and ELISA Kit Solutions

FBXW8 Antibody - middle region (ARP55585_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP55585_P050-FITC Conjugated

ARP55585_P050-HRP Conjugated

ARP55585_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
F-box and WD repeat domain containing 8
NCBI Gene Id:
Protein Name:
F-box/WD repeat-containing protein 8
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FBW6, FBW8, FBX29, FBXO29, MGC33534, FBXW6
Replacement Item:
This antibody may replace item sc-145115 from Santa Cruz Biotechnology.
Description of Target:
FBXW8 is a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXW8 contains a WD-40 domain, in addition to an F-box motif, so it belongs to the Fbw class.This gene encodes a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene contains a WD-40 domain, in addition to an F-box motif, so it belongs to the Fbw class. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FBXW8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FBXW8.
The immunogen is a synthetic peptide directed towards the middle region of human FBXW8
Predicted Homology Based on Immunogen Sequence:
Cow: 83%; Dog: 92%; Guinea Pig: 83%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%
Complete computational species homology data:
Anti-FBXW8 (ARP55585_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHR
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FBXW8 (ARP55585_P050) antibody is Catalog # AAP55585 (Previous Catalog # AAPP34146)
Printable datasheet for anti-FBXW8 (ARP55585_P050) antibody
Target Reference:
Tsutsumi,T., (2008) Mol. Cell. Biol. 28 (2), 743-751

Lin, P. et al. Fbxw8 is involved in the proliferation of human choriocarcinoma JEG-3 cells. Mol. Biol. Rep. 38, 1741-7 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 20878477

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...