Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

FBXW8 Antibody - middle region (ARP55585_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP55585_P050-FITC Conjugated

ARP55585_P050-HRP Conjugated

ARP55585_P050-Biotin Conjugated

Gene Symbol:
FBXW8
Official Gene Full Name:
F-box and WD repeat domain containing 8
NCBI Gene Id:
26259
Protein Name:
F-box/WD repeat-containing protein 8
Swissprot Id:
Q8N3Y1
Protein Accession #:
NP_699179
Nucleotide Accession #:
NM_153348
Alias Symbols:
FBW6, FBW8, FBX29, FBXO29, MGC33534, FBXW6
Replacement Item:
This antibody may replace item sc-145115 from Santa Cruz Biotechnology.
Description of Target:
FBXW8 is a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXW8 contains a WD-40 domain, in addition to an F-box motif, so it belongs to the Fbw class.This gene encodes a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene contains a WD-40 domain, in addition to an F-box motif, so it belongs to the Fbw class. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
Protein Size (# AA):
598
Molecular Weight:
67kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FBXW8.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FBXW8.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human FBXW8
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 83%; Dog: 92%; Guinea Pig: 83%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%
Complete computational species homology data:
Anti-FBXW8 (ARP55585_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MAP4K1; CUL1; TBC1D3; CUL7; UBE2D3; SKP1; IRS1; REST; CCND1; CUL4A; DDB1; UBC; CCDC8; GORASP1; OBSL1; CCT6B; CCT2; CCT7; TRIP13; PDCD5; CUL2; VBP1; CCT3; PFDN5; NFKBIA; CCT6A; BCL3; BTRC; SKP2; HSP90AA1; HSPA4; FBXO4; FBXW8; FBXW2; MYC; RBX1; UBI4; EP300;
Blocking Peptide:
For anti-FBXW8 (ARP55585_P050) antibody is Catalog # AAP55585 (Previous Catalog # AAPP34146)
Datasheets/Manuals:
Printable datasheet for anti-FBXW8 (ARP55585_P050) antibody
Target Reference:
Tsutsumi,T., (2008) Mol. Cell. Biol. 28 (2), 743-751
Publications:

Lin, P. et al. Fbxw8 is involved in the proliferation of human choriocarcinoma JEG-3 cells. Mol. Biol. Rep. 38, 1741-7 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 20878477

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...