Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP55585_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP55585_P050-FITC Conjugated

ARP55585_P050-HRP Conjugated

ARP55585_P050-Biotin Conjugated

FBXW8 Antibody - middle region (ARP55585_P050)

Catalog#: ARP55585_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-145115 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human FBXW8
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 83%; Dog: 92%; Guinea Pig: 83%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%
Complete computational species homology data Anti-FBXW8 (ARP55585_P050)
Peptide Sequence Synthetic peptide located within the following region: MNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHR
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FBXW8 (ARP55585_P050) antibody is Catalog # AAP55585 (Previous Catalog # AAPP34146)
Datasheets/Manuals Printable datasheet for anti-FBXW8 (ARP55585_P050) antibody
Target Reference Tsutsumi,T., (2008) Mol. Cell. Biol. 28 (2), 743-751
Publications

Lin, P. et al. Fbxw8 is involved in the proliferation of human choriocarcinoma JEG-3 cells. Mol. Biol. Rep. 38, 1741-7 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 20878477

Gene Symbol FBXW8
Official Gene Full Name F-box and WD repeat domain containing 8
Alias Symbols FBW6, FBW8, FBX29, FBXO29, MGC33534, FBXW6
NCBI Gene Id 26259
Protein Name F-box/WD repeat-containing protein 8
Description of Target FBXW8 is a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXW8 contains a WD-40 domain, in addition to an F-box motif, so it belongs to the Fbw class.This gene encodes a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene contains a WD-40 domain, in addition to an F-box motif, so it belongs to the Fbw class. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
Swissprot Id Q8N3Y1
Protein Accession # NP_699179
Nucleotide Accession # NM_153348
Protein Size (# AA) 598
Molecular Weight 67kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FBXW8.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FBXW8.
Protein Interactions MAP4K1; CUL1; TBC1D3; CUL7; UBE2D3; SKP1; IRS1; REST; CCND1; CUL4A; DDB1; UBC; CCDC8; GORASP1; OBSL1; CCT6B; CCT2; CCT7; TRIP13; PDCD5; CUL2; VBP1; CCT3; PFDN5; NFKBIA; CCT6A; BCL3; BTRC; SKP2; HSP90AA1; HSPA4; FBXO4; FBXW8; FBXW2; MYC; RBX1; UBI4; EP300;
Write Your Own Review
You're reviewing:FBXW8 Antibody - middle region (ARP55585_P050)
Your Rating