Catalog No: ARP53144_P050
Price: $0.00
SKU
ARP53144_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

FBXO39 Antibody - middle region (ARP53144_P050)

Datasheets/ManualsPrintable datasheet for anti-FBXO39 (ARP53144_P050) antibody
Product Info
ReferenceJin,J., (2004) Genes Dev. 18 (21), 2573-2580
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human FBXO39
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 79%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: RQCALRVFKARIYTNRYETNEEDKTLQEIYRKYRKLIESELSYFVIVYSV
Concentration0.5 mg/ml
Blocking PeptideFor anti-FBXO39 (ARP53144_P050) antibody is Catalog # AAP53144 (Previous Catalog # AAPP36212)
Gene SymbolFBXO39
Gene Full NameF-box protein 39
Alias SymbolsCT144, Fbx39, FBOX39
NCBI Gene Id162517
Protein NameF-box only protein 39
Description of TargetFBXO39 is the substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXO39, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM].
Uniprot IDQ8N4B4
Protein Accession #NP_694962
Nucleotide Accession #NM_153230
Protein Size (# AA)442
Molecular Weight53kDa
  1. What is the species homology for "FBXO39 Antibody - middle region (ARP53144_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "FBXO39 Antibody - middle region (ARP53144_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FBXO39 Antibody - middle region (ARP53144_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FBXO39 Antibody - middle region (ARP53144_P050)"?

    This target may also be called "CT144, Fbx39, FBOX39" in publications.

  5. What is the shipping cost for "FBXO39 Antibody - middle region (ARP53144_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FBXO39 Antibody - middle region (ARP53144_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FBXO39 Antibody - middle region (ARP53144_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "53kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FBXO39 Antibody - middle region (ARP53144_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "FBXO39"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FBXO39"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FBXO39"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FBXO39"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FBXO39"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FBXO39"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FBXO39 Antibody - middle region (ARP53144_P050)
Your Rating
We found other products you might like!