FBXO28 Antibody - middle region : HRP (ARP55192_P050-HRP)

Catalog No: ARP55192_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FBXO28
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: ELERKLREVMESAVGNSSGSGQNEESPRKRKKATEAIDSLRKSKRLRNRK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FBXO28 (ARP55192_P050-HRP) antibody is Catalog # AAP55192 (Previous Catalog # AAPP33019)
• Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Target Info

• Gene Symbol: FBXO28
• Gene Full Name: F-box protein 28
• Alias Symbols: Fbx28, CENP-30
• NCBI Gene Id: 23219
• Protein Name: F-box only protein 28
• Description of Target: Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO28, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM].
• Uniprot ID: Q9NVF7
• Protein Accession #: NP_055991
• Nucleotide Accession #: NM_015176
• Protein Size (# AA): 368
• Molecular Weight: 41kDa
• Protein Interactions: PLEKHF2; SDCBP2; SPAG5; SKP1; GOLGA2; PAK1; LYN; HSP90AA1; GK; UBC; PSMB1; Cep55; TRAF2;