FBXO21 Antibody - N-terminal region : HRP (ARP43175_P050-HRP)

Catalog No: ARP43175_P050-HRP

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Yeast
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FBXO21
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%
• Peptide Sequence: Synthetic peptide located within the following region: KEQFRVRWPSLMKHYSPTDYVNWLEEYKVRQKAGLEARKIVASFSKRFFS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FBXO21 (ARP43175_P050-HRP) antibody is Catalog # AAP43175 (Previous Catalog # AAPP25144)
• Sample Type Confirmation:

  FBXO21 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

• Reference: Nakayama,M., (2002) Genome Res. 12 (11), 1773-1784

Target Info

• Gene Symbol: FBXO21
• Gene Full Name: F-box protein 21
• Alias Symbols: FBX21
• NCBI Gene Id: 23014
• Protein Name: F-box only protein 21
• Description of Target: FBXO21 contains 1 F-box domain. It is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternative splicing of this gene generates 2 transcript variants.
• Uniprot ID: O94952
• Protein Accession #: NP_055817
• Nucleotide Accession #: NM_015002
• Protein Size (# AA): 621
• Molecular Weight: 71kDa
• Protein Interactions: TP53; CDKN1A; SUMO1; SMURF1; NEDD8; UBC; COPS5; COPS6; CUL1; ELAVL1; CNTNAP4; TERF2; TERF1;