- Gene Symbol:
- FBXO21
- NCBI Gene Id:
- 23014
- Official Gene Full Name:
- F-box protein 21
- Protein Name:
- F-box only protein 21
- Swissprot Id:
- O94952
- Protein Accession #:
- NP_055817
- Nucleotide Accession #:
- NM_015002
- Alias Symbols:
- DKFZp434G058, FBX21, FLJ90233, KIAA0875, MGC26682
- Description of Target:
- FBXO21 contains 1 F-box domain. It is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternative splicing of this gene generates 2 transcript variants.
- Protein Size (# AA):
- 621
- Molecular Weight:
- 71kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- IHC, WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express FBXO21.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express FBXO21.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the N terminal region of human FBXO21
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%
- Complete computational species homology data:
- Anti-FBXO21 (ARP43175_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: KEQFRVRWPSLMKHYSPTDYVNWLEEYKVRQKAGLEARKIVASFSKRFFS
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- TP53; CDKN1A; SUMO1; SMURF1; NEDD8; UBC; COPS5; COPS6; CUL1; ELAVL1; CNTNAP4; TERF2; TERF1;
- Blocking Peptide:
- For anti-FBXO21 (ARP43175_P050) antibody is Catalog # AAP43175 (Previous Catalog # AAPP25144)
- Datasheets/Manuals:
- Printable datasheet for anti-FBXO21 (ARP43175_P050) antibody
- Sample Type Confirmation:
FBXO21 is strongly supported by BioGPS gene expression data to be expressed in HEK293T
- Target Reference:
- Nakayama,M., (2002) Genome Res. 12 (11), 1773-1784
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
