Search Antibody, Protein, and ELISA Kit Solutions

FBXO21 antibody - N-terminal region (ARP43175_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43175_P050-FITC Conjugated

ARP43175_P050-HRP Conjugated

ARP43175_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
F-box protein 21
Protein Name:
F-box only protein 21
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
DKFZp434G058, FBX21, FLJ90233, KIAA0875, MGC26682
Description of Target:
FBXO21 contains 1 F-box domain. It is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternative splicing of this gene generates 2 transcript variants.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FBXO21.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FBXO21.
The immunogen is a synthetic peptide directed towards the N terminal region of human FBXO21
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%
Complete computational species homology data:
Anti-FBXO21 (ARP43175_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KEQFRVRWPSLMKHYSPTDYVNWLEEYKVRQKAGLEARKIVASFSKRFFS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FBXO21 (ARP43175_P050) antibody is Catalog # AAP43175 (Previous Catalog # AAPP25144)
Printable datasheet for anti-FBXO21 (ARP43175_P050) antibody
Sample Type Confirmation:

FBXO21 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Target Reference:
Nakayama,M., (2002) Genome Res. 12 (11), 1773-1784

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...