FBXO21 antibody - N-terminal region (ARP43175_P050)

Catalog#: ARP43175_P050
Domestic: within 1-2 days delivery International: 1-2 days

Human HEK293T

Human Lung Tissue

Click here to learn more about Aviva's By-Request Conjugation Service.

Size:	100 ul
Price:	$289.00
Availability: In Stock
Qty:
Request Bulk Order Quote

Go To Shopping Cart

Conjugation Options

ARP43175_P050-FITC Conjugated

ARP43175_P050-HRP Conjugated

ARP43175_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.

Gene Symbol:: FBXO21
NCBI Gene Id:: 23014
Official Gene Full Name:: F-box protein 21
Protein Name:: F-box only protein 21
Swissprot Id:: O94952
Protein Accession #:: NP_055817
Nucleotide Accession #:: NM_015002
Alias Symbols:: DKFZp434G058, FBX21, FLJ90233, KIAA0875, MGC26682
Description of Target:: FBXO21 contains 1 F-box domain. It is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternative splicing of this gene generates 2 transcript variants.
Protein Size (# AA):: 621
Molecular Weight:: 71kDa
Host:: Rabbit
Clonality:: Polyclonal
Purification:: Affinity Purified
Application:: IHC, WB
Tissue Tool:: Find tissues and cell lines supported by DNA array analysis to express FBXO21.
RNA Seq:: Find tissues and cell lines supported by RNA-seq analysis to express FBXO21.
Immunogen:: The immunogen is a synthetic peptide directed towards the N terminal region of human FBXO21
Tested Species Reactivity:: Human
Predicted Homology Based on Immunogen Sequence:: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%
Complete computational species homology data:: Anti-FBXO21 (ARP43175_P050)
Peptide Sequence:: Synthetic peptide located within the following region: KEQFRVRWPSLMKHYSPTDYVNWLEEYKVRQKAGLEARKIVASFSKRFFS
Product Format:: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:: TP53; CDKN1A; SUMO1; SMURF1; NEDD8; UBC; COPS5; COPS6; CUL1; ELAVL1; CNTNAP4; TERF2; TERF1;
Blocking Peptide:: For anti-FBXO21 (ARP43175_P050) antibody is Catalog # AAP43175 (Previous Catalog # AAPP25144)
Datasheets/Manuals:: Printable datasheet for anti-FBXO21 (ARP43175_P050) antibody
Sample Type Confirmation:: FBXO21 is strongly supported by BioGPS gene expression data to be expressed in HEK293T