Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43327_P050-FITC Conjugated

ARP43327_P050-HRP Conjugated

ARP43327_P050-Biotin Conjugated

FBXO11 Antibody - middle region (ARP43327_P050)

Catalog#: ARP43327_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, CHIP
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-130473 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human FBXO11
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-FBXO11 (ARP43327_P050)
Peptide Sequence Synthetic peptide located within the following region: HDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQ
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FBXO11 (ARP43327_P050) antibody is Catalog # AAP43327 (Previous Catalog # AAPP26480)
Datasheets/Manuals Printable datasheet for anti-FBXO11 (ARP43327_P050) antibody
Sample Type Confirmation

FBXO11 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Target Reference Lee,M.J., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (1), 100-105
Gene Symbol FBXO11
Official Gene Full Name F-box protein 11
Alias Symbols FBX11, FLJ12673, MGC44383, PRMT9, UG063H01, VIT1, UBR6
NCBI Gene Id 80204
Protein Name Fbxo11-prov protein EMBL AAH76869.1
Description of Target FBXO11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternatively spliced transcript variants encoding distinct isoforms have been identified for FBXO11.This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
Swissprot Id Q6DF73
Protein Accession # NP_079409
Nucleotide Accession # NM_025133
Protein Size (# AA) 843
Molecular Weight 94kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FBXO11.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FBXO11.
Protein Interactions SKP1; ERN1; DTL; CUL1; EED; UBC; NEDD8; COPS5; COPS6; ELAVL1; USP16; HDAC6; BCL6; RBX1; TP53;
  1. What is the species homology for "FBXO11 Antibody - middle region (ARP43327_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "FBXO11 Antibody - middle region (ARP43327_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FBXO11 Antibody - middle region (ARP43327_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "FBXO11 Antibody - middle region (ARP43327_P050)"?

    This target may also be called "FBX11, FLJ12673, MGC44383, PRMT9, UG063H01, VIT1, UBR6" in publications.

  5. What is the shipping cost for "FBXO11 Antibody - middle region (ARP43327_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FBXO11 Antibody - middle region (ARP43327_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FBXO11 Antibody - middle region (ARP43327_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "94kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FBXO11 Antibody - middle region (ARP43327_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FBXO11"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FBXO11"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FBXO11"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FBXO11"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FBXO11"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FBXO11"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FBXO11 Antibody - middle region (ARP43327_P050)
Your Rating