Search Antibody, Protein, and ELISA Kit Solutions

FBXO11 Antibody - middle region (ARP43327_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP43327_P050-FITC Conjugated

ARP43327_P050-HRP Conjugated

ARP43327_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, CHIP
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-130473 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human FBXO11
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-FBXO11 (ARP43327_P050)
Peptide Sequence:
Synthetic peptide located within the following region: HDVEFIRHDRFFCDCGAGTLSNPCTLAGEPTHDTDTLYDSAPPIESNTLQ
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-FBXO11 (ARP43327_P050) antibody is Catalog # AAP43327 (Previous Catalog # AAPP26480)
Datasheets/Manuals:
Printable datasheet for anti-FBXO11 (ARP43327_P050) antibody
Sample Type Confirmation:

FBXO11 is strongly supported by BioGPS gene expression data to be expressed in HEK293T

Target Reference:
Lee,M.J., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (1), 100-105
Gene Symbol:
FBXO11
Official Gene Full Name:
F-box protein 11
Alias Symbols:
FBX11, FLJ12673, MGC44383, PRMT9, UG063H01, VIT1, UBR6
NCBI Gene Id:
80204
Protein Name:
Fbxo11-prov protein EMBL AAH76869.1
Description of Target:
FBXO11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternatively spliced transcript variants encoding distinct isoforms have been identified for FBXO11.This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene.
Swissprot Id:
Q6DF73
Protein Accession #:
NP_079409
Nucleotide Accession #:
NM_025133
Protein Size (# AA):
843
Molecular Weight:
94kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FBXO11.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FBXO11.
Protein Interactions:
SKP1; ERN1; DTL; CUL1; EED; UBC; NEDD8; COPS5; COPS6; ELAVL1; USP16; HDAC6; BCL6; RBX1; TP53;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...