FBP1 Antibody - N-terminal region (ARP41406_T100)

Size:100 ul

Human Jurkat

Human Kidney

Human Lung

Basic Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Jurkat cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Replacement Item: This antibody may replace item sc-121348, HPA005857
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FBP1
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 86%; Zebrafish: 80%
• Complete computational species homology data: Anti-FBP1 (ARP41406_T100)
• Peptide Sequence: Synthetic peptide located within the following region: YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-FBP1 (ARP41406_T100) antibody is Catalog # AAP41406 (Previous Catalog # AAPP24144)
• Datasheets/Manuals: Printable datasheet for anti-FBP1 (ARP41406_T100) antibody
• Target Reference: Yanez,A.J., (2005) J. Cell. Physiol. 205 (1), 19-24
• Publications:

  Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 24465277

Target Info

• Gene Symbol: FBP1
• Official Gene Full Name: Fructose-1,6-bisphosphatase 1
• Alias Symbols: FBP
• NCBI Gene Id: 2203
• Protein Name: Fructose-1,6-bisphosphatase 1
• Description of Target: Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.
• Swissprot Id: P09467
• Protein Accession #: NP_000498
• Nucleotide Accession #: NM_000507
• Protein Size (# AA): 338
• Molecular Weight: 37kDa
• Tissue Tool: Find tissues and cell lines supported by DNA array analysis to express FBP1.
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express FBP1.
• Protein Interactions: FBP2; FBP1; BIN1; KLRC2; ASL; UBC; POT1; TERF1; PARK2; HDAC6; PTK2; DYNC1I1; CSNK1E; BCL2L1; LNX1; PCNXL4; ATP5J2; ASCC2; RNF183; HSPA8; FXR2; ACTN1;