Search Antibody, Protein, and ELISA Kit Solutions

FBP1 Antibody - N-terminal region (ARP41406_T100)

100 ul

Regular Price: $249.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP41406_T100-FITC Conjugated

ARP41406_T100-HRP Conjugated

ARP41406_T100-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Additional Information:
IHC Information: Jurkat cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-121348, HPA005857
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human FBP1
Purification:
Protein A purified
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 86%; Zebrafish: 80%
Complete computational species homology data:
Anti-FBP1 (ARP41406_T100)
Peptide Sequence:
Synthetic peptide located within the following region: YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-FBP1 (ARP41406_T100) antibody is Catalog # AAP41406 (Previous Catalog # AAPP24144)
Datasheets/Manuals:
Printable datasheet for anti-FBP1 (ARP41406_T100) antibody
Target Reference:
Yanez,A.J., (2005) J. Cell. Physiol. 205 (1), 19-24
Publications:

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 24465277

Gene Symbol:
FBP1
Official Gene Full Name:
Fructose-1,6-bisphosphatase 1
Alias Symbols:
FBP
NCBI Gene Id:
2203
Protein Name:
Fructose-1,6-bisphosphatase 1
Description of Target:
Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.
Swissprot Id:
P09467
Protein Accession #:
NP_000498
Nucleotide Accession #:
NM_000507
Protein Size (# AA):
338
Molecular Weight:
37kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FBP1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FBP1.
Protein Interactions:
FBP2; FBP1; BIN1; KLRC2; ASL; UBC; POT1; TERF1; PARK2; HDAC6; PTK2; DYNC1I1; CSNK1E; BCL2L1; LNX1; PCNXL4; ATP5J2; ASCC2; RNF183; HSPA8; FXR2; ACTN1;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...