Size:100 ul
Special Price $229.00 Regular Price $249.00
In Stock
SKU
ARP41406_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41406_T100-FITC Conjugated

ARP41406_T100-HRP Conjugated

ARP41406_T100-Biotin Conjugated

FBP1 Antibody - N-terminal region (ARP41406_T100)

Catalog#: ARP41406_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Additional Information IHC Information: Jurkat cell lysate. Antibody concentration: 1.25 ug/ml. Gel concentration: 12%.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-121348, HPA005857
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FBP1
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 86%; Zebrafish: 80%
Complete computational species homology data Anti-FBP1 (ARP41406_T100)
Peptide Sequence Synthetic peptide located within the following region: YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FBP1 (ARP41406_T100) antibody is Catalog # AAP41406 (Previous Catalog # AAPP24144)
Datasheets/Manuals Printable datasheet for anti-FBP1 (ARP41406_T100) antibody
Target Reference Yanez,A.J., (2005) J. Cell. Physiol. 205 (1), 19-24
Publications

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 24465277

Gene Symbol FBP1
Official Gene Full Name Fructose-1,6-bisphosphatase 1
Alias Symbols FBP
NCBI Gene Id 2203
Protein Name Fructose-1,6-bisphosphatase 1
Description of Target Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.
Swissprot Id P09467
Protein Accession # NP_000498
Nucleotide Accession # NM_000507
Protein Size (# AA) 338
Molecular Weight 37kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FBP1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FBP1.
Protein Interactions FBP2; FBP1; BIN1; KLRC2; ASL; UBC; POT1; TERF1; PARK2; HDAC6; PTK2; DYNC1I1; CSNK1E; BCL2L1; LNX1; PCNXL4; ATP5J2; ASCC2; RNF183; HSPA8; FXR2; ACTN1;
  1. What is the species homology for "FBP1 Antibody - N-terminal region (ARP41406_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "FBP1 Antibody - N-terminal region (ARP41406_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FBP1 Antibody - N-terminal region (ARP41406_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FBP1 Antibody - N-terminal region (ARP41406_T100)"?

    This target may also be called "FBP" in publications.

  5. What is the shipping cost for "FBP1 Antibody - N-terminal region (ARP41406_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FBP1 Antibody - N-terminal region (ARP41406_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FBP1 Antibody - N-terminal region (ARP41406_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "37kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FBP1 Antibody - N-terminal region (ARP41406_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FBP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FBP1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FBP1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FBP1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FBP1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FBP1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FBP1 Antibody - N-terminal region (ARP41406_T100)
Your Rating
We found other products you might like!