Size:100 ul
Special Price $229.00 Regular Price $249.00
In Stock
SKU
ARP40366_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40366_T100-FITC Conjugated

ARP40366_T100-HRP Conjugated

ARP40366_T100-Biotin Conjugated

FBL Antibody - N-terminal region (ARP40366_T100)

Catalog#: ARP40366_T100
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human FBL
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology dataAnti-FBL (ARP40366_T100)
Peptide SequenceSynthetic peptide located within the following region: GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKN
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-FBL (ARP40366_T100) antibody is Catalog # AAP40366 (Previous Catalog # AAPP22110)
Datasheets/ManualsPrintable datasheet for anti-FBL (ARP40366_T100) antibody
Sample Type Confirmation

FBL is supported by BioGPS gene expression data to be expressed in Jurkat

Target ReferenceBouwmeester,T., (2004) Nat. Cell Biol. 6 (2), 97-105
Publications

Armistead, J. et al. Mutation of a gene essential for ribosome biogenesis, EMG1, causes Bowen-Conradi syndrome. Am. J. Hum. Genet. 84, 728-39 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 19463982

Ernoult-Lange, M. et al. Nucleocytoplasmic traffic of CPEB1 and accumulation in Crm1 nucleolar bodies. Mol. Biol. Cell 20, 176-87 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 18923137

Gene SymbolFBL
Official Gene Full NameFibrillarin
Alias SymbolsFIB, FLRN, RNU3IP1
NCBI Gene Id2091
Protein NamerRNA 2'-O-methyltransferase fibrillarin
Description of TargetFBL is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. FBL contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin.This gene product is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. The encoded protein contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin.
Swissprot IdP22087
Protein Accession #NP_001427
Nucleotide Accession #NM_001436
Protein Size (# AA)321
Molecular Weight35kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express FBL.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express FBL.
Protein InteractionsUBC; CEP250; TP53; SUMO2; SUMO3; LIN28A; LIN28B; RPA3; RPA2; RPA1; ERG; RNF2; BMI1; SUZ12; EED; EZH2; TARDBP; UBD; NCL; ARFGEF1; PAN2; CBX8; ITGA4; FN1; VCAM1; MAGOH; EIF4A3; EEF1A1; DHX15; NSUN2; NOP58; MRTO4; GNL3; RSL1D1; SRRM2; BOP1; RRS1; EBNA1BP2; P
Write Your Own Review
You're reviewing:FBL Antibody - N-terminal region (ARP40366_T100)
Your Rating
Aviva Live Chat
Aviva HIS tag Deal
Assay Development
Aviva Pathways