Search Antibody, Protein, and ELISA Kit Solutions

FBL Antibody - N-terminal region (ARP40366_T100)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP40366_T100-FITC Conjugated

ARP40366_T100-HRP Conjugated

ARP40366_T100-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
FBL
Official Gene Full Name:
Fibrillarin
NCBI Gene Id:
2091
Protein Name:
rRNA 2'-O-methyltransferase fibrillarin
Swissprot Id:
P22087
Protein Accession #:
NP_001427
Nucleotide Accession #:
NM_001436
Alias Symbols:
FIB, FLRN, RNU3IP1
Description of Target:
FBL is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. FBL contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin.This gene product is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. The encoded protein contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin.
Protein Size (# AA):
321
Molecular Weight:
35kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FBL.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FBL.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human FBL
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data:
Anti-FBL (ARP40366_T100)
Peptide Sequence:
Synthetic peptide located within the following region: GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; CEP250; TP53; SUMO2; SUMO3; LIN28A; LIN28B; RPA3; RPA2; RPA1; ERG; RNF2; BMI1; SUZ12; EED; EZH2; TARDBP; UBD; NCL; ARFGEF1; PAN2; CBX8; ITGA4; FN1; VCAM1; MAGOH; EIF4A3; EEF1A1; DHX15; NSUN2; NOP58; MRTO4; GNL3; RSL1D1; SRRM2; BOP1; RRS1; EBNA1BP2; P
Blocking Peptide:
For anti-FBL (ARP40366_T100) antibody is Catalog # AAP40366 (Previous Catalog # AAPP22110)
Datasheets/Manuals:
Printable datasheet for anti-FBL (ARP40366_T100) antibody
Sample Type Confirmation:

FBL is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Bouwmeester,T., (2004) Nat. Cell Biol. 6 (2), 97-105
Publications:

Armistead, J. et al. Mutation of a gene essential for ribosome biogenesis, EMG1, causes Bowen-Conradi syndrome. Am. J. Hum. Genet. 84, 728-39 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 19463982

Ernoult-Lange, M. et al. Nucleocytoplasmic traffic of CPEB1 and accumulation in Crm1 nucleolar bodies. Mol. Biol. Cell 20, 176-87 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 18923137

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...