Size:100 ul
Special Price $229.00 Regular Price $249.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP40366_T100-FITC Conjugated

ARP40366_T100-HRP Conjugated

ARP40366_T100-Biotin Conjugated

FBL Antibody - N-terminal region (ARP40366_T100)

Catalog#: ARP40366_T100
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human FBL
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Complete computational species homology data Anti-FBL (ARP40366_T100)
Peptide Sequence Synthetic peptide located within the following region: GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKN
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FBL (ARP40366_T100) antibody is Catalog # AAP40366 (Previous Catalog # AAPP22110)
Datasheets/Manuals Printable datasheet for anti-FBL (ARP40366_T100) antibody
Sample Type Confirmation

FBL is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference Bouwmeester,T., (2004) Nat. Cell Biol. 6 (2), 97-105

Armistead, J. et al. Mutation of a gene essential for ribosome biogenesis, EMG1, causes Bowen-Conradi syndrome. Am. J. Hum. Genet. 84, 728-39 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 19463982

Ernoult-Lange, M. et al. Nucleocytoplasmic traffic of CPEB1 and accumulation in Crm1 nucleolar bodies. Mol. Biol. Cell 20, 176-87 (2009). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 18923137

Gene Symbol FBL
Official Gene Full Name Fibrillarin
Alias Symbols FIB, FLRN, RNU3IP1
NCBI Gene Id 2091
Protein Name rRNA 2'-O-methyltransferase fibrillarin
Description of Target FBL is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. FBL contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin.This gene product is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. The encoded protein contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin.
Swissprot Id P22087
Protein Accession # NP_001427
Nucleotide Accession # NM_001436
Protein Size (# AA) 321
Molecular Weight 35kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FBL.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FBL.
Protein Interactions UBC; CEP250; TP53; SUMO2; SUMO3; LIN28A; LIN28B; RPA3; RPA2; RPA1; ERG; RNF2; BMI1; SUZ12; EED; EZH2; TARDBP; UBD; NCL; ARFGEF1; PAN2; CBX8; ITGA4; FN1; VCAM1; MAGOH; EIF4A3; EEF1A1; DHX15; NSUN2; NOP58; MRTO4; GNL3; RSL1D1; SRRM2; BOP1; RRS1; EBNA1BP2; P
  1. What is the species homology for "FBL Antibody - N-terminal region (ARP40366_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "FBL Antibody - N-terminal region (ARP40366_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FBL Antibody - N-terminal region (ARP40366_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "FBL Antibody - N-terminal region (ARP40366_T100)"?

    This target may also be called "FIB, FLRN, RNU3IP1" in publications.

  5. What is the shipping cost for "FBL Antibody - N-terminal region (ARP40366_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FBL Antibody - N-terminal region (ARP40366_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FBL Antibody - N-terminal region (ARP40366_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "35kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FBL Antibody - N-terminal region (ARP40366_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FBL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FBL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FBL"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FBL"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FBL"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FBL"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FBL Antibody - N-terminal region (ARP40366_T100)
Your Rating
We found other products you might like!