Catalog No: OPCA58375
Price: $0.00
SKU
OPCA58375
Availability: Please Inquire. Lead time depends on expression system.
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for OPCA58375 |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | Lyophilized powder |
Application | WB, ELISA |
Additional Information | For Research Use Only. Sterile filtering available upon request. Low endotoxin available upon request. |
Reconstitution and Storage | Briefly centrifuge lyophilized product prior to opening to bring the contents to the bottom. Please reconstitute protein to 0.1-1.0 mg/mL by adding deionized sterile water first, followed by addition of glycerol to a final concentration of 5-50%. Reconstituted product should be aliquoted for long-term storage at -20C/-80C. Our in house default final concentration of glycerol is 50% for reference. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGG |
Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Tag | This protein may contain a N-terminal tag or C-terminal tag based on protein stability requirements. |
Gene Symbol | FAU |
---|---|
Gene Full Name | FAU, ubiquitin like and ribosomal protein S30 fusion |
Alias Symbols | S30, FAU1, Fub1, Fubi, asr1, RPS30, MNSFbeta |
NCBI Gene Id | 2197 |
Protein Name | ubiquitin-like protein fubi and ribosomal protein S30 |
Description of Target | This gene is the cellular homolog of the fox sequence in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). It encodes a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome and displays antimicrobial activity. Pseudogenes derived from this gene are present in the genome. Similar to ribosomal protein S30, ribosomal proteins S27a and L40 are synthesized as fusion proteins with ubiquitin. |
Uniprot ID | P35544 |
Protein Accession # | NP_001988.1 |
Nucleotide Accession # | NM_001997.4 |
Protein Size (# AA) | 74 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review