Catalog No: ARP54604_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

FAU Antibody - middle region (ARP54604_P050)

Datasheets/ManualsPrintable datasheet for anti-FAU (ARP54604_P050) antibody
Product Info
ReferenceYu,Y., (2005) Protein Sci. 14 (6), 1438-1446
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ApplicationWB, IHC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human FAU
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS
Concentration0.5 mg/ml
Blocking PeptideFor anti-FAU (ARP54604_P050) antibody is Catalog # AAP54604 (Previous Catalog # AAPP31388)
Sample Type Confirmation

FAU is supported by BioGPS gene expression data to be expressed in 721_B, Jurkat, MCF7

Enhanced Validation
Gene SymbolFAU
Gene Full NameFinkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed
Alias SymbolsS30, FAU1, Fub1, Fubi, asr1, RPS30, MNSFbeta
NCBI Gene Id2197
Protein Name40S ribosomal protein S30
Description of TargetFAU is a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome.This gene is the cellular homolog of the fox sequence in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). It encodes a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome. Pseudogenes derived from this gene are present in the genome. Similar to ribosomal protein S30, ribosomal proteins S27a and L40 are synthesized as fusion proteins with ubiquitin. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDP62861
Protein Accession #NP_001988
Nucleotide Accession #NM_001997
Protein Size (# AA)133
Molecular Weight8 kDa
Protein InteractionsTP53; UBC; RPS17; rev; WIBG; PNO1; TSR1; PA2G4; RPSA; HDLBP; BYSL; RPS27L; G3BP1; DYNLL1; SPTAN1; RPS29; RPS28; RPS27; RPS26; RPS25; RPS24; RPS23; RPS20; RPS19; RPS18; RPS16; RPS15A; RPS13; RPS9; RPS7; RPS6; RPS4X; RPS3; RPL18; PTBP1; ICAM1; CD81; IGSF8;
  1. What is the species homology for "FAU Antibody - middle region (ARP54604_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "FAU Antibody - middle region (ARP54604_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FAU Antibody - middle region (ARP54604_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "FAU Antibody - middle region (ARP54604_P050)"?

    This target may also be called "S30, FAU1, Fub1, Fubi, asr1, RPS30, MNSFbeta" in publications.

  5. What is the shipping cost for "FAU Antibody - middle region (ARP54604_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FAU Antibody - middle region (ARP54604_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FAU Antibody - middle region (ARP54604_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "8 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FAU Antibody - middle region (ARP54604_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "FAU"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FAU"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FAU"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FAU"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FAU"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FAU"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FAU Antibody - middle region (ARP54604_P050)
Your Rating
We found other products you might like!