Search Antibody, Protein, and ELISA Kit Solutions

FASTK Antibody - C-terminal region (ARP85802_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
FASTK
Official Gene Full Name:
Fas activated serine/threonine kinase
NCBI Gene Id:
10922
Protein Name:
fas-activated serine/threonine kinase
Swissprot Id:
Q14296-3
Protein Accession #:
NP_001245390.1
Nucleotide Accession #:
NM_001258461.1
Alias Symbols:
FAST
Description of Target:
The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase was shown to be activated rapidly during Fas-mediated apoptosis in Jurkat cells. In response to Fas receptor ligation, it phosphorylates TIA1, an apoptosis-promoting nuclear RNA-binding protein. The encoded protein is a strong inducer of lymphocyte apoptosis. Two transcript variants encoding different isoforms have been found for this gene. Other variants exist, but their full-length natures have not yet been determined.
Protein Size (# AA):
522
Molecular Weight:
57 kDa
Purification:
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FASTK.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FASTK.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human FASTK
Peptide Sequence:
Synthetic peptide located within the following region: VLLGSRALRERHLGLMGYQLLPLPFEELESQRGLPQLKSYLRQKLQALGL
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-FASTK (ARP85802_P050) antibody is Catalog # AAP85802
Datasheets/Manuals:
Printable datasheet for anti-FASTK (ARP85802_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...