Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP85802_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

FASTK Antibody - C-terminal region (ARP85802_P050)

Catalog#: ARP85802_P050
Domestic: within 24 hours delivery | International: 3-5 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human FASTK
Purification Affinity purified
Peptide Sequence Synthetic peptide located within the following region: VLLGSRALRERHLGLMGYQLLPLPFEELESQRGLPQLKSYLRQKLQALGL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-FASTK (ARP85802_P050) antibody is Catalog # AAP85802
Datasheets/Manuals Printable datasheet for anti-FASTK (ARP85802_P050) antibody
Gene Symbol FASTK
Official Gene Full Name Fas activated serine/threonine kinase
Alias Symbols FAST
NCBI Gene Id 10922
Protein Name fas-activated serine/threonine kinase
Description of Target The protein encoded by this gene is a member of the serine/threonine protein kinase family. This kinase was shown to be activated rapidly during Fas-mediated apoptosis in Jurkat cells. In response to Fas receptor ligation, it phosphorylates TIA1, an apoptosis-promoting nuclear RNA-binding protein. The encoded protein is a strong inducer of lymphocyte apoptosis. Two transcript variants encoding different isoforms have been found for this gene. Other variants exist, but their full-length natures have not yet been determined.
Swissprot Id Q14296-3
Protein Accession # NP_001245390.1
Nucleotide Accession # NM_001258461.1
Protein Size (# AA) 522
Molecular Weight 57 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express FASTK.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express FASTK.
  1. What is the species homology for "FASTK Antibody - C-terminal region (ARP85802_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "FASTK Antibody - C-terminal region (ARP85802_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "FASTK Antibody - C-terminal region (ARP85802_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FASTK Antibody - C-terminal region (ARP85802_P050)"?

    This target may also be called "FAST" in publications.

  5. What is the shipping cost for "FASTK Antibody - C-terminal region (ARP85802_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FASTK Antibody - C-terminal region (ARP85802_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FASTK Antibody - C-terminal region (ARP85802_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "57 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FASTK Antibody - C-terminal region (ARP85802_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FASTK"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FASTK"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FASTK"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FASTK"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FASTK"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FASTK"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FASTK Antibody - C-terminal region (ARP85802_P050)
Your Rating
We found other products you might like!