- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-FAS (ARP59115_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Goat, Pig |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human FAS |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Goat: 100%; Human: 100%; Pig: 93% |
Peptide Sequence | Synthetic peptide located within the following region: GLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSK |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-FAS (ARP59115_P050) antibody is Catalog # AAP59115 (Previous Catalog # AAPP45328) |
Sample Type Confirmation | FAS is strongly supported by BioGPS gene expression data to be expressed in NCI-H226 |
Gene Symbol | FAS |
---|---|
Gene Full Name | Fas (TNF receptor superfamily, member 6) |
Alias Symbols | APT1, CD95, FAS1, APO-1, FASTM, ALPS1A, TNFRSF6 |
NCBI Gene Id | 355 |
Protein Name | Tumor necrosis factor receptor superfamily member 6 |
Description of Target | FAS is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. At least eight alternatively spliced transcript variants encoding seven distinct isoforms have been described. The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform. |
Uniprot ID | P25445 |
Protein Accession # | NP_000034 |
Nucleotide Accession # | NM_000043 |
Protein Size (# AA) | 335 |
Molecular Weight | 36kDa |
Protein Interactions | FADD; CAV1; FAS; APOA5; TMX1; UBQLN1; MBD4; TP63; TCAP; BAG6; UBC; HNRNPC; GADD45A; CCND3; ATP6V0B; SQSTM1; Ube2i; PRAM1; RARA; PML; DAXX; FASLG; TRADD; MAP3K5; BMX; Traf1; FAF1; FAF2; TRAF3; KRIT1; TNF; BRE; LRIF1; FEM1B; FBF1; FAIM2; CASP8AP2; C14orf1; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "FAS Antibody - N-terminal region (ARP59115_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Goat, Pig".
-
How long will it take to receive "FAS Antibody - N-terminal region (ARP59115_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "FAS Antibody - N-terminal region (ARP59115_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "FAS Antibody - N-terminal region (ARP59115_P050)"?
This target may also be called "APT1, CD95, FAS1, APO-1, FASTM, ALPS1A, TNFRSF6" in publications.
-
What is the shipping cost for "FAS Antibody - N-terminal region (ARP59115_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "FAS Antibody - N-terminal region (ARP59115_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "FAS Antibody - N-terminal region (ARP59115_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "36kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "FAS Antibody - N-terminal region (ARP59115_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "FAS"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "FAS"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "FAS"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "FAS"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "FAS"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "FAS"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.