FARS2 Antibody - N-terminal region (ARP40669_T100)

Catalog No: ARP40669_T100

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-FARS2 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T

Rabbit Anti-FARS2 Antibody
Catalog Number: ARP40669
Paraffin Embedded Tissue: Human Muscle
Cellular Data: Skeletal muscle cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FARS2
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 92%; Guinea Pig: 85%; Horse: 83%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: VELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQ
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-FARS2 (ARP40669_T100) antibody is Catalog # AAP40669 (Previous Catalog # AAPY00921)
• Reference: Brandenberger,R., (2004) Nat. Biotechnol. 22 (6), 707-716

Target Info

• Gene Symbol: FARS2
• Gene Full Name: Phenylalanyl-tRNA synthetase 2, mitochondrial
• Alias Symbols: FARS1, PheRS, SPG77, COXPD14, HSPC320, mtPheRS
• NCBI Gene Id: 10667
• Protein Name: Phenylalanine--tRNA ligase, mitochondrial
• Description of Target: Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. FARS2 is a phenylalanine-tRNA synthetase (PheRS) localized to the mitochondrion which consists of a single polypeptide chain, unlike the (alpha-beta)2 structure of the prokaryotic and eukaryotic cytoplasmic forms of PheRS. Structure analysis and catalytic properties indicate mitochondrial PheRSs may constitute a class of PheRS distinct from the enzymes found in prokaryotes and in the eukaryotic cytoplasm.Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. FARS1 encodes a mitochondrially-located phenylalanine-tRNA synthetase (PheRS) which consists of a single polypeptide chain unlike the (alpha-beta)2 structure of the prokaryotic and eukaryotic cytoplasmic forms of PheRS. Structure analysis and catalytic properties indicate mitochondrial PheRSs may constitute a class of PheRS distinct from the enzymes found in prokaryotes and the eukaryotic cytoplasm.
• Uniprot ID: O95363
• Protein Accession #: NP_006558
• Nucleotide Accession #: NM_006567
• Protein Size (# AA): 451
• Molecular Weight: 50kDa
• Protein Interactions: TRIM27; KRT31; KRT13; RCBTB2; NOTCH2NL; KRTAP10-3; KRTAP10-5; KRTAP10-9; KRTAP10-7; KRT40; CMTM5; HMBOX1; TRIM54; AGTRAP; ADAMTSL4; APPL1; IKZF3; MID2; CALCOCO2; STX11; MKRN3; TFCP2; TADA2A; SUMO1; UBC; NEDD8; CUL3; ISG15; ICT1; USP45; G3BP2;