Search Antibody, Protein, and ELISA Kit Solutions

FANCL Antibody - middle region (ARP56321_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP56321_P050-FITC Conjugated

ARP56321_P050-HRP Conjugated

ARP56321_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Dog, Human, Rabbit
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-117142 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the middle region of human FANCL
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Dog: 93%; Human: 100%; Rabbit: 86%
Complete computational species homology data:
Anti-FANCL (ARP56321_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQVNSPQSSLISIY
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-FANCL (ARP56321_P050) antibody is Catalog # AAP56321 (Previous Catalog # AAPP38333)
Printable datasheet for anti-FANCL (ARP56321_P050) antibody
Sample Type Confirmation:

FANCL is supported by BioGPS gene expression data to be expressed in HEK293

Target Reference:
Bethke,L., (2008) J. Natl. Cancer Inst. 100 (4), 270-276
Gene Symbol:
Official Gene Full Name:
Fanconi anemia, complementation group L
Alias Symbols:
FAAP43, FLJ10335, PHF9, POG
NCBI Gene Id:
Protein Name:
E3 ubiquitin-protein ligase FANCL
Description of Target:
The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FAN
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FANCL.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FANCL.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...