Search Antibody, Protein, and ELISA Kit Solutions

FANCL antibody - middle region (ARP56321_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP56321_P050-FITC Conjugated

ARP56321_P050-HRP Conjugated

ARP56321_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Fanconi anemia, complementation group L
Protein Name:
E3 ubiquitin-protein ligase FANCL
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
FAAP43, FLJ10335, PHF9, POG
Replacement Item:
This antibody may replace item sc-117142 from Santa Cruz Biotechnology.
Description of Target:
The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FAN
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FANCL.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FANCL.
The immunogen is a synthetic peptide directed towards the middle region of human FANCL
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Dog: 93%; Human: 100%; Rabbit: 86%
Complete computational species homology data:
Anti-FANCL (ARP56321_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQVNSPQSSLISIY
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FANCL (ARP56321_P050) antibody is Catalog # AAP56321 (Previous Catalog # AAPP38333)
Printable datasheet for anti-FANCL (ARP56321_P050) antibody
Sample Type Confirmation:

FANCL is supported by BioGPS gene expression data to be expressed in HEK293

Target Reference:
Bethke,L., (2008) J. Natl. Cancer Inst. 100 (4), 270-276

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...