Size:100 ul
$319.00
In stock
SKU
ARP56321_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP56321_P050-FITC Conjugated

ARP56321_P050-HRP Conjugated

ARP56321_P050-Biotin Conjugated

FANCL Antibody - middle region (ARP56321_P050)

Catalog#: ARP56321_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityDog, Human, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-117142 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human FANCL
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 93%; Human: 100%; Rabbit: 86%
Complete computational species homology dataAnti-FANCL (ARP56321_P050)
Peptide SequenceSynthetic peptide located within the following region: ASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQVNSPQSSLISIY
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-FANCL (ARP56321_P050) antibody is Catalog # AAP56321 (Previous Catalog # AAPP38333)
Datasheets/ManualsPrintable datasheet for anti-FANCL (ARP56321_P050) antibody
Sample Type Confirmation

FANCL is supported by BioGPS gene expression data to be expressed in HEK293

Target ReferenceBethke,L., (2008) J. Natl. Cancer Inst. 100 (4), 270-276
Gene SymbolFANCL
Official Gene Full NameFanconi anemia, complementation group L
Alias SymbolsFAAP43, FLJ10335, PHF9, POG
NCBI Gene Id55120
Protein NameE3 ubiquitin-protein ligase FANCL
Description of TargetThe Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FAN
Swissprot IdQ9NW38
Protein Accession #NP_001108108
Nucleotide Accession #NM_001114636
Protein Size (# AA)380
Molecular Weight42kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express FANCL.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express FANCL.
Protein InteractionsCCDC36; STRA13; RBM45; SSX2IP; RIMBP3; LZTS2; DOCK8; EIF4ENIF1; CHCHD3; IKZF3; TFCP2; KIFC3; GRN; C1orf86; C17orf70; FANCM; UBC; FANCG; FANCF; UBE2W; UBE2T; FANCI; FANCD2; UBD; FANCA; CTNNB1; FANCB; FANCL; C19orf40; FANCC; HES1; APITD1; PCNA; GGN; BMPR1B;
Write Your Own Review
You're reviewing:FANCL Antibody - middle region (ARP56321_P050)
Your Rating
Aviva HIS tag Deal
Aviva Tissue Tool
Assay Development
Free Microscope