Search Antibody, Protein, and ELISA Kit Solutions

FANCL Antibody - middle region (ARP56321_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP56321_P050-FITC Conjugated

ARP56321_P050-HRP Conjugated

ARP56321_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Dog, Human, Rabbit
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
FANCL
Official Gene Full Name:
Fanconi anemia, complementation group L
NCBI Gene Id:
55120
Protein Name:
E3 ubiquitin-protein ligase FANCL
Swissprot Id:
Q9NW38
Protein Accession #:
NP_001108108
Nucleotide Accession #:
NM_001114636
Alias Symbols:
FAAP43, FLJ10335, PHF9, POG
Replacement Item:
This antibody may replace item sc-117142 from Santa Cruz Biotechnology.
Description of Target:
The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FAN
Protein Size (# AA):
380
Molecular Weight:
42kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FANCL.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FANCL.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human FANCL
Predicted Homology Based on Immunogen Sequence:
Dog: 93%; Human: 100%; Rabbit: 86%
Complete computational species homology data:
Anti-FANCL (ARP56321_P050)
Peptide Sequence:
Synthetic peptide located within the following region: ASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQVNSPQSSLISIY
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CCDC36; STRA13; RBM45; SSX2IP; RIMBP3; LZTS2; DOCK8; EIF4ENIF1; CHCHD3; IKZF3; TFCP2; KIFC3; GRN; C1orf86; C17orf70; FANCM; UBC; FANCG; FANCF; UBE2W; UBE2T; FANCI; FANCD2; UBD; FANCA; CTNNB1; FANCB; FANCL; C19orf40; FANCC; HES1; APITD1; PCNA; GGN; BMPR1B;
Blocking Peptide:
For anti-FANCL (ARP56321_P050) antibody is Catalog # AAP56321 (Previous Catalog # AAPP38333)
Datasheets/Manuals:
Printable datasheet for anti-FANCL (ARP56321_P050) antibody
Sample Type Confirmation:

FANCL is supported by BioGPS gene expression data to be expressed in HEK293

Target Reference:
Bethke,L., (2008) J. Natl. Cancer Inst. 100 (4), 270-276

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...