FAM76A Antibody - N-terminal region : Biotin (ARP53097_P050-Biotin)

Catalog No: ARP53097_P050-Biotin

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM76A
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 85%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Peptide Sequence: Synthetic peptide located within the following region: MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FAM76A (ARP53097_P050-Biotin) antibody is Catalog # AAP53097 (Previous Catalog # AAPP35330)

Target Info

• Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321
• Gene Symbol: FAM76A
• Gene Full Name: Family with sequence similarity 76, member A
• Alias Symbols: MGC34648, RP3-426I6.1
• NCBI Gene Id: 199870
• Protein Name: Protein FAM76A
• Description of Target: The specific function of FAM76A is not yet known.
• Uniprot ID: Q8TAV0
• Protein Accession #: NP_689873
• Nucleotide Accession #: NM_152660
• Protein Size (# AA): 307
• Molecular Weight: 35kDa
• Protein Interactions: UBC; ELAVL1;