FAM193A Antibody - C-terminal region : HRP (ARP70392_P050-HRP)

Catalog No: ARP70392_P050-HRP

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Zebrafish
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM193A
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 85%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Rat: 93%; Zebrafish: 85%
• Peptide Sequence: Synthetic peptide located within the following region: EHQQNSKLVLAESPQPKGKNKKNKKKKGDRVNNSIDGVSLLLPSLGYNGA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FAM193A (ARP70392_P050-HRP) antibody is Catalog # AAP70392
• Sample Type Confirmation:

  FAM193A is supported by BioGPS gene expression data to be expressed in HEK293T

Target Info

• Gene Symbol: FAM193A
• Alias Symbols: C4orf8, RES4-22
• NCBI Gene Id: 8603
• Protein Name: Protein FAM193A
• Description of Target: The function of this protein remains unknown.
• Uniprot ID: P78312
• Protein Accession #: NP_003695
• Nucleotide Accession #: NM_003704
• Protein Size (# AA): 1265
• Molecular Weight: 139kDa
• Protein Interactions: ANKRD28;