ANTIBODY AND ELISA PROMOS

20% off all ELISAs • Two for the price of one on select antibodies.

Don’t miss out on these great offers! Learn More Here.

Catalog No: ARP70392_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP70392_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

FAM193A Antibody - C-terminal region : FITC (ARP70392_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-FAM193A (ARP70392_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Horse, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human FAM193A
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 85%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Rat: 93%; Zebrafish: 85%
Peptide SequenceSynthetic peptide located within the following region: EHQQNSKLVLAESPQPKGKNKKNKKKKGDRVNNSIDGVSLLLPSLGYNGA
Concentration0.5 mg/ml
Blocking PeptideFor anti-FAM193A (ARP70392_P050-FITC) antibody is Catalog # AAP70392
Sample Type Confirmation

FAM193A is supported by BioGPS gene expression data to be expressed in HEK293T

Gene SymbolFAM193A
Alias SymbolsC4orf8, RES4-22
NCBI Gene Id8603
Protein NameProtein FAM193A
Description of TargetThe function of this protein remains unknown.
Uniprot IDP78312
Protein Accession #NP_003695
Nucleotide Accession #NM_003704
Protein Size (# AA)1265
Molecular Weight139kDa
Protein InteractionsANKRD28;
  1. What is the species homology for "FAM193A Antibody - C-terminal region : FITC (ARP70392_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Horse, Zebrafish".

  2. How long will it take to receive "FAM193A Antibody - C-terminal region : FITC (ARP70392_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FAM193A Antibody - C-terminal region : FITC (ARP70392_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FAM193A Antibody - C-terminal region : FITC (ARP70392_P050-FITC)"?

    This target may also be called "C4orf8, RES4-22" in publications.

  5. What is the shipping cost for "FAM193A Antibody - C-terminal region : FITC (ARP70392_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FAM193A Antibody - C-terminal region : FITC (ARP70392_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FAM193A Antibody - C-terminal region : FITC (ARP70392_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "139kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FAM193A Antibody - C-terminal region : FITC (ARP70392_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "FAM193A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FAM193A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FAM193A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FAM193A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FAM193A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FAM193A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FAM193A Antibody - C-terminal region : FITC (ARP70392_P050-FITC)
Your Rating
We found other products you might like!