Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

FAM162A Antibody - N-terminal region : FITC (ARP73955_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP73955_P050 Unconjugated

ARP73955_P050-HRP Conjugated

ARP73955_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
FAM162A
Official Gene Full Name:
family with sequence similarity 162 member A
NCBI Gene Id:
26355
Protein Name:
protein FAM162A
Swissprot Id:
Q96A26
Protein Accession #:
NP_055182
Alias Symbols:
E2IG5, HGTD-P, C3orf28
Protein Size (# AA):
154
Molecular Weight:
16kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FAM162A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FAM162A.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human F162A
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: SLRLTRSSDLKRINGFCTKPQESPGAPSRTYNRVPLHKPTDWQKKILIWS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
UBC; TIMM23B; ADRB2; HSP90AA1; UBL4A; PTRF; IWS1; RMDN3; SRRT; MRPL22; HACL1; TM9SF4; VDAC2; SSR3; SLC25A1;
Blocking Peptide:
For anti-FAM162A (ARP73955_P050-FITC) antibody is Catalog # AAP73955
Datasheets/Manuals:
Printable datasheet for anti-FAM162A (ARP73955_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...