Catalog No: ARP52843_P050
Price: $0.00
SKU
ARP52843_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-METTL21A (ARP52843_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human FAM119A
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: ALVPYEETTEFGLQKFHKPLATFSFANHTIQIRQDWRHLGVAAVVWDAAI
Concentration0.5 mg/ml
Blocking PeptideFor anti-METTL21A (ARP52843_P050) antibody is Catalog # AAP52843 (Previous Catalog # AAPP33903)
ReferenceOta,T., (2004) Nat. Genet. 36 (1), 40-45
Gene SymbolMETTL21A
Gene Full NameMethyltransferase like 21A
Alias SymbolsFAM119A, HCA557b, HSPA-KMT
NCBI Gene Id151194
Protein NameMethyltransferase-like protein 21A
Description of TargetFAM119A is a multi-pass membrane protein. It belongs to the FAM119 family. The function of the FAM119A protein remains unknown.
Uniprot IDQ8WXB1
Protein Accession #NP_660323
Nucleotide Accession #NM_145280
Protein Size (# AA)218
Molecular Weight25 kDa
Protein InteractionsATRIP; LNX1; BAG3; DYNC1H1; METTL21C; METTL21A; NCALD; VCPKMT; CCDC88A; HSPBP1; HSPA4L; HSPH1; HSPA9; HSPA8; HSPA7; HSPA5; HSPA4; HSPA2; HSPA1L; HSPA1A;
  1. What is the species homology for "FAM119A Antibody - N-terminal region (ARP52843_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "FAM119A Antibody - N-terminal region (ARP52843_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FAM119A Antibody - N-terminal region (ARP52843_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FAM119A Antibody - N-terminal region (ARP52843_P050)"?

    This target may also be called "FAM119A, HCA557b, HSPA-KMT" in publications.

  5. What is the shipping cost for "FAM119A Antibody - N-terminal region (ARP52843_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FAM119A Antibody - N-terminal region (ARP52843_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FAM119A Antibody - N-terminal region (ARP52843_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "25 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FAM119A Antibody - N-terminal region (ARP52843_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "METTL21A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "METTL21A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "METTL21A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "METTL21A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "METTL21A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "METTL21A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FAM119A Antibody - N-terminal region (ARP52843_P050)
Your Rating
We found other products you might like!