Catalog No: OAAF07560 (Formerly GWB-ASB427)
Size:100 ug
Price: $344.00
SKU
OAAF07560
Availability: Domestic: within 1-2 week delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for FAK Antibody (Phospho-Ser910) (OAAF07560)
Product Info
Predicted Species ReactivityHuman|Mouse|Rat
ClonalityPolyclonal
HostRabbit
ApplicationEnzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin
Additional InformationModification Sites: Human:S910 Mouse:S948 Rat:S913
Reconstitution and Storage-20°C
ImmunogenThe antiserum was produced against synthesized peptide derived from human FAK around the phosphorylation site of Ser910.
PurificationThe antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide.
Peptide SequenceSynthetic peptide located within the following region: PPRPGAPGHLGSLASLSSPADSYNEGVKLQPQEISPPPTANLDRSNDKVY
Concentration1mg/ml
SpecificityFAK (Phospho-Ser910) Antibody detects endogenous levels of FAK only when phosphorylated at Ser910.
FormulationRabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol.
Application Info
IHC: 1:50~1:100
IF: 1:100~1:500
ELISA: 1:1000
Gene SymbolPTK2
Gene Full Nameprotein tyrosine kinase 2
Alias SymbolsFADK;FADK 1;FAK;FAK1;FAK-related non-kinase polypeptide;focal adhesion kinase 1;focal adhesion kinase-related nonkinase;FRNK;p125FAK;pp125FAK;PPP1R71;protein phosphatase 1 regulatory subunit 71;Protein-tyrosine kinase 2;PTK2 protein tyrosine kinase 2.
NCBI Gene Id5747
Protein NameFocal adhesion kinase 1
Description of TargetNon-receptor protein-tyrosine kinase that plays an essential role in regulating cell migration, adhesion, spreading, reorganization of the actin cytoskeleton, formation and disassembly of focal adhesions and cell protrusions, cell cycle progression, cell proliferation and apoptosis. Required for early embryonic development and placenta development. Required for embryonic angiogenesis, normal cardiomyocyte migration and proliferation, and normal heart development. Regulates axon growth and neuronal cell migration, axon branching and synapse formation; required for normal development of the nervous system. Plays a role in osteogenesis and differentiation of osteoblasts. Functions in integrin signal transduction, but also in signaling downstream of numerous growth factor receptors, G-protein coupled receptors (GPCR), EPHA2, netrin receptors and LDL receptors. Forms multisubunit signaling complexes with SRC and SRC family members upon activation; this leads to the phosphorylation of additional tyrosine residues, creating binding sites for scaffold proteins, effectors and substrates. Regulates numerous signaling pathways. Promotes activation of phosphatidylinositol 3-kinase and the AKT1 signaling cascade. Promotes activation of MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling cascade. Promotes localized and transient activation of guanine nucleotide exchange factors (GEFs) and GTPase-activating proteins (GAPs), and thereby modulates the activity of Rho family GTPases. Signaling via CAS family members mediates activation of RAC1. Recruits the ubiquitin ligase MDM2 to P53/TP53 in the nucleus, and thereby regulates P53/TP53 activity, P53/TP53 ubiquitination and proteasomal degradation. Phosphorylates SRC; this increases SRC kinase activity. Phosphorylates ACTN1, ARHGEF7, GRB7, RET and WASL. Promotes phosphorylation of PXN and STAT1; most likely PXN and STAT1 are phosphorylated by a SRC family kinase that is recruited to autophosphorylated PTK2/FAK1, rather than by PTK2/FAK1 itself. Promotes phosphorylation of BCAR1; GIT2 and SHC1; this requires both SRC and PTK2/FAK1. Promotes phosphorylation of BMX and PIK3R1. Isoform 6 (FRNK) does not contain a kinase domain and inhibits PTK2/FAK1 phosphorylation and signaling. Its enhanced expression can attenuate the nuclear accumulation of LPXN and limit its ability to enhance serum response factor (SRF)-dependent gene transcription.
Uniprot IDQ05397
Molecular Weight119 kDa
  1. What is the species homology for "FAK Antibody (Phospho-Ser910) (OAAF07560)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse|Rat".

  2. How long will it take to receive "FAK Antibody (Phospho-Ser910) (OAAF07560)"?

    This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".

  3. What buffer format is "FAK Antibody (Phospho-Ser910) (OAAF07560)" provided in?

    This item is provided in "".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FAK Antibody (Phospho-Ser910) (OAAF07560)"?

    This target may also be called "FADK;FADK 1;FAK;FAK1;FAK-related non-kinase polypeptide;focal adhesion kinase 1;focal adhesion kinase-related nonkinase;FRNK;p125FAK;pp125FAK;PPP1R71;protein phosphatase 1 regulatory subunit 71;Protein-tyrosine kinase 2;PTK2 protein tyrosine kinase 2." in publications.

  5. What is the shipping cost for "FAK Antibody (Phospho-Ser910) (OAAF07560)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FAK Antibody (Phospho-Ser910) (OAAF07560)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FAK Antibody (Phospho-Ser910) (OAAF07560)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "119 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FAK Antibody (Phospho-Ser910) (OAAF07560)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PTK2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PTK2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PTK2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PTK2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PTK2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PTK2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FAK Antibody (Phospho-Ser910) (OAAF07560)
Your Rating
We found other products you might like!