FAIM Antibody - N-terminal region (ARP56237_P050)

Catalog No: ARP56237_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-FAIM Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAIM
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FAIM (ARP56237_P050) antibody is Catalog # AAP56237 (Previous Catalog # AAPP38206)

Target Info

• Reference: Segura,M.F., (2007) J. Neurosci. 27 (42), 11228-11241
• Gene Symbol: FAIM
• Gene Full Name: Fas apoptotic inhibitory molecule
• Alias Symbols: FAIM1
• NCBI Gene Id: 55179
• Protein Name: Fas apoptotic inhibitory molecule 1
• Description of Target: FAIM plays a role as an inducible effector molecule that mediates Fas resistance produced by surface Ig engagement in B cells.
• Uniprot ID: Q9NVQ4
• Protein Accession #: NP_001028202
• Nucleotide Accession #: NM_001033030
• Protein Size (# AA): 213
• Molecular Weight: 24kDa
• Protein Interactions: SPRY2; UBC; XIAP;