Search Antibody, Protein, and ELISA Kit Solutions

FAH antibody - C-terminal region (ARP41681_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41681_T100-FITC Conjugated

ARP41681_T100-HRP Conjugated

ARP41681_T100-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Fumarylacetoacetate hydrolase (fumarylacetoacetase)
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Replacement Item:
This antibody may replace item sc-62356 from Santa Cruz Biotechnology.
Description of Target:
FAH is the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia.This gene encodes the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia (HT).
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FAH.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FAH.
The immunogen is a synthetic peptide directed towards the C terminal region of human FAH
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-FAH (ARP41681_T100)
Peptide Sequence:
Synthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-FAH (ARP41681_T100) antibody is Catalog # AAP41681 (Previous Catalog # AAPP24324)
Printable datasheet for anti-FAH (ARP41681_T100) antibody
Additional Information:
IHC Information: Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
Target Reference:
Bliksrud,Y.T., (2005) J. Mol. Med. 83 (5), 406-410

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 24465277

Calattini, S; Fusil, F; Mancip, J; Dao Thi, VL; Granier, C; Gadot, N; Scoazec, JY; Zeisel, MB; Baumert, TF; Lavillette, D; Dreux, M; Cosset, FL; Functional and Biochemical Characterization of Hepatitis C Virus (HCV) Particles Produced in a Humanized Liver Mouse Model. 290, 23173-87 (2015). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26224633

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...