Loading...
Catalog No: ARP41681_T100 (Formerly GWB-MN915F)
Price: $0.00
SKU
ARP41681_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-FAH (ARP41681_T100) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human FAH
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG
Concentration1.0 mg/ml
Blocking PeptideFor anti-FAH (ARP41681_T100) antibody is Catalog # AAP41681 (Previous Catalog # AAPP24324)
Other Applications Image 1 DataSample Type: Human Liver and Mouse FAH KO liver
Primary Dilution: 1:400
ReferenceBliksrud,Y.T., (2005) J. Mol. Med. 83 (5), 406-410
Publications

Functional and Biochemical Characterization of Hepatitis C Virus (HCV) Particles Produced in a Humanized Liver Mouse Model. J. Biol. Chem. 290, 23173-87 (2015). 26224633

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). 24465277

Gene SymbolFAH
Gene Full NameFumarylacetoacetate hydrolase (fumarylacetoacetase)
NCBI Gene Id2184
Protein NameFumarylacetoacetase
Description of TargetFAH is the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia.This gene encodes the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia (HT).
Uniprot IDP16930
Protein Accession #NP_000128
Nucleotide Accession #NM_000137
Protein Size (# AA)419
Molecular Weight46kDa
Protein InteractionsKRTAP10-8; ADAMTSL4; SERTAD1; TCF4; KRTAP5-9; UBC; EGFR;
  1. What is the species homology for "FAH Antibody - C-terminal region (ARP41681_T100)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "FAH Antibody - C-terminal region (ARP41681_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FAH Antibody - C-terminal region (ARP41681_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FAH Antibody - C-terminal region (ARP41681_T100)"?

    This target may also be called "" in publications.

  5. What is the shipping cost for "FAH Antibody - C-terminal region (ARP41681_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FAH Antibody - C-terminal region (ARP41681_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FAH Antibody - C-terminal region (ARP41681_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "46kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FAH Antibody - C-terminal region (ARP41681_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "FAH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FAH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FAH"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FAH"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FAH"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FAH"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FAH Antibody - C-terminal region (ARP41681_T100)
Your Rating
We found other products you might like!