Size:100 ul
$249.00
In stock
SKU
ARP41681_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41681_T100-FITC Conjugated

ARP41681_T100-HRP Conjugated

ARP41681_T100-Biotin Conjugated

FAH Antibody - C-terminal region (ARP41681_T100)

Catalog#: ARP41681_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-62356 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human FAH
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Complete computational species homology dataAnti-FAH (ARP41681_T100)
Peptide SequenceSynthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-FAH (ARP41681_T100) antibody is Catalog # AAP41681 (Previous Catalog # AAPP24324)
Datasheets/ManualsPrintable datasheet for anti-FAH (ARP41681_T100) antibody
Other Applications Image 1 DataSample Type: Human Liver and Mouse FAH KO liver
Primary Dilution: 1:400
Target ReferenceBliksrud,Y.T., (2005) J. Mol. Med. 83 (5), 406-410
Publications

Calattini, S; Fusil, F; Mancip, J; Dao Thi, VL; Granier, C; Gadot, N; Scoazec, JY; Zeisel, MB; Baumert, TF; Lavillette, D; Dreux, M; Cosset, FL; Functional and Biochemical Characterization of Hepatitis C Virus (HCV) Particles Produced in a Humanized Liver Mouse Model. 290, 23173-87 (2015). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 26224633

Hu, Z. et al. Quantitative liver-specific protein fingerprint in blood: a signature for hepatotoxicity. Theranostics 4, 215-28 (2014). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 24465277

Gene SymbolFAH
Official Gene Full NameFumarylacetoacetate hydrolase (fumarylacetoacetase)
NCBI Gene Id2184
Protein NameFumarylacetoacetase
Description of TargetFAH is the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia.This gene encodes the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia (HT).
Swissprot IdP16930
Protein Accession #NP_000128
Nucleotide Accession #NM_000137
Protein Size (# AA)419
Molecular Weight46kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express FAH.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express FAH.
Protein InteractionsKRTAP10-8; ADAMTSL4; SERTAD1; TCF4; KRTAP5-9; UBC; EGFR;
Write Your Own Review
You're reviewing:FAH Antibody - C-terminal region (ARP41681_T100)
Your Rating
Aviva Pathways
Aviva ChIP Antibodies
Aviva Tips and Tricks
Aviva Live Chat