Size:100 ul
Special Price $229.00 Regular Price $249.00
In Stock
SKU
ARP33827_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP33827_T100-FITC Conjugated

ARP33827_T100-HRP Conjugated

ARP33827_T100-Biotin Conjugated

FABP7 Antibody - N-terminal region (ARP33827_T100)

Catalog#: ARP33827_T100
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human FABP7
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Complete computational species homology dataAnti-FABP7 (ARP33827_T100)
Peptide SequenceSynthetic peptide located within the following region: NFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISF
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-FABP7 (ARP33827_T100) antibody is Catalog # AAP33827 (Previous Catalog # AAPP04893)
Datasheets/ManualsPrintable datasheet for anti-FABP7 (ARP33827_T100) antibody
Target ReferenceWang,M., et al., (2003) J. Biol. Chem. 278 (47), 47319-47325
Publications

Sun, Y. et al. A gel-based proteomic method reveals several protein pathway abnormalities in fetal Down syndrome brain. J. Proteomics 74, 547-57 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21262400

Gene SymbolFABP7
Official Gene Full NameFatty acid binding protein 7, brain
Alias SymbolsMRG, BLBP, FABPB, B-FABP
NCBI Gene Id2173
Protein NameFatty acid-binding protein, brain
Description of TargetThe protein encoded by FABP7 is a brain fatty acid binding protein. Fatty acid binding proteins (FABPs) are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs are thought to play roles in fatty acid uptake, transport, and metabolism.
Swissprot IdO15540
Protein Accession #NP_001437
Nucleotide Accession #NM_001446
Protein Size (# AA)132
Molecular Weight15kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express FABP7.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express FABP7.
  1. What is the species homology for "FABP7 Antibody - N-terminal region (ARP33827_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "FABP7 Antibody - N-terminal region (ARP33827_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FABP7 Antibody - N-terminal region (ARP33827_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FABP7 Antibody - N-terminal region (ARP33827_T100)"?

    This target may also be called "MRG, BLBP, FABPB, B-FABP" in publications.

  5. What is the shipping cost for "FABP7 Antibody - N-terminal region (ARP33827_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "FABP7 Antibody - N-terminal region (ARP33827_T100)"?

    All Aviva products have been through vigorous validations and carry 100% satisfaction warranty.

  7. Can I get bulk pricing for "FABP7 Antibody - N-terminal region (ARP33827_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "15kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FABP7 Antibody - N-terminal region (ARP33827_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "FABP7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FABP7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FABP7"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FABP7"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FABP7"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FABP7"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:FABP7 Antibody - N-terminal region (ARP33827_T100)
Your Rating
Aviva Live Chat
Free Microscope
Aviva Blast Tool
Aviva Tissue Tool