Search Antibody, Protein, and ELISA Kit Solutions

FABP7 antibody - N-terminal region (ARP33827_T100)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP33827_T100-FITC Conjugated

ARP33827_T100-HRP Conjugated

ARP33827_T100-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Fatty acid binding protein 7, brain
Protein Name:
Fatty acid-binding protein, brain
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
The protein encoded by FABP7 is a brain fatty acid binding protein. Fatty acid binding proteins (FABPs) are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs are thought to play roles in fatty acid uptake, transport, and metabolism.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express FABP7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express FABP7.
The immunogen is a synthetic peptide directed towards the N terminal region of human FABP7
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Complete computational species homology data:
Anti-FABP7 (ARP33827_T100)
Peptide Sequence:
Synthetic peptide located within the following region: NFDEYMKALGVGFATRQVGNVTKPTVIISQEGDKVVIRTLSTFKNTEISF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-FABP7 (ARP33827_T100) antibody is Catalog # AAP33827 (Previous Catalog # AAPP04893)
Printable datasheet for anti-FABP7 (ARP33827_T100) antibody
Target Reference:
Wang,M., et al., (2003) J. Biol. Chem. 278 (47), 47319-47325

Sun, Y. et al. A gel-based proteomic method reveals several protein pathway abnormalities in fetal Down syndrome brain. J. Proteomics 74, 547-57 (2011). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21262400

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...