FABP7 Antibody - middle region (ARP89952_P050)

Catalog No: ARP89952_P050

Host: Rabbit
Target Name: FABP7
Sample Tissue: Mouse Skeletal Muscle lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Mouse
• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse FABP7
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: ALGVGFATRQVGNVTKPTVIISQEGGKVVIRTQCTFKNTEINFQLGEEFE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-FABP7 (ARP89952_P050) antibody is Catalog # AAP89952

Target Info

• Gene Symbol: FABP7
• Gene Full Name: fatty acid binding protein 7, brain
• Alias Symbols: Bl, BFA, MRG, B-FA, Blbp, BFABP, B-FABP
• NCBI Gene Id: 12140
• Protein Name: fatty acid-binding protein, brain
• Description of Target: B-FABP could be involved in the transport of a so far unknown hydrophobic ligand with potential morphogenic activity during CNS development. It is required for the establishment of the radial glial fiber system in developing brain, a system that is necessary for the migration of immature neurons to establish cortical layers.
• Uniprot ID: P51880
• Protein Accession #: NP_067247.1
• Nucleotide Accession #: NM_021272.3
• Protein Size (# AA): 132
• Molecular Weight: 14 kDa